PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g55080.1
Common NameLOC4334170, Os03g0758000, OSJNBa0040E01.4, WRKY3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 315aa    MW: 32733.4 Da    PI: 5.869
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g55080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.4e-33135192259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp+vv++tYeg+H h+
  LOC_Os03g55080.1 135 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSDDPSVVITTYEGQHCHH 192
                       8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.5E-34119193IPR003657WRKY domain
SuperFamilySSF1182901.57E-28126193IPR003657WRKY domain
PROSITE profilePS5081129.964129194IPR003657WRKY domain
SMARTSM007748.6E-39134193IPR003657WRKY domain
PfamPF031064.3E-26135192IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAGAEWSPFD GDAAFAEYSS AVLAELGGWA APGEEGGAGM MVPAALDLPV DVVGAAAREE  60
EEEEEEAPAR SGDGAAAAAS SSSSGEPAAP DKRPAAAEAA PAAAATATAT AKKGQKRARQ  120
PRFAFMTKSE IDHLEDGYRW RKYGQKAVKN SPFPRSYYRC TNSKCTVKKR VERSSDDPSV  180
VITTYEGQHC HHTASFQRGV GGAAVAAHIH GAAAVALAEQ MSAFVSPPPQ PHMLYGLPRL  240
HPPSSETAVS CSMPTTTSLQ ELNNSEGLQR PGYNNSPQAA VTIAQRPPSP SVPPAVSFDK  300
GLLDDIVPPG VRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-26124191774Probable WRKY transcription factor 4
2lex_A5e-26124191774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.506450.0callus| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335192050.0
Expression AtlasQ9AUV7-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g55080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g55080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418590.0AY341859.1 Oryza sativa (japonica cultivar-group) WRKY19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631421.10.0PREDICTED: probable WRKY transcription factor 57
RefseqXP_015631422.10.0PREDICTED: probable WRKY transcription factor 57
TrEMBLQ9AUV70.0Q9AUV7_ORYSJ; Os03g0758000 protein
STRINGLOC_Os03g55080.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.25e-48WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]