PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g54160.2
Common NameAGL10, LOC4334140, MADS14, OJ1112_G08.13, Os03g0752800, OsJ_12598, OSJNBa0032E21.04, OSJNBa0047E24.2, RAP1B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28422.5 Da    PI: 9.4786
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g54160.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.1e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyey++
  LOC_Os03g54160.2  9 KRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYAT 59
                      79***********************************************86 PP

2K-box107.91.2e-3579173599
             K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                          s+e+ ++ ++++e++kLk+++e++q+ q+hl+GedLesL+lkeLqqLeqqLe+slk+iRs+K++l+le+i+elq+kek+lqeenk L+k+
  LOC_Os03g54160.2  79 VLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKE 171
                       55567788899********************************************************************************99 PP

             K-box  98 le 99 
                       l 
  LOC_Os03g54160.2 172 LV 173
                       85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.941161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-34286IPR002100Transcription factor, MADS-box
CDDcd002654.40E-41276No hitNo description
PRINTSPR004041.8E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-3084172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.85588178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KANEISVLCD AEVALIIFST KGKLYEYATD  60
SCMDKILERY ERYSYAEKVL ISAESDTQGN WCHEYRKLKA KVETIQKCQK HLMGEDLESL  120
NLKELQQLEQ QLENSLKHIR SRKSQLMLES INELQRKEKS LQEENKVLQK ELVEKQKVQK  180
QQVQWDQTQP QTSSSSSSFM MREALPTTNI SNYPAAAGER IEDVAAGQPQ HVRIGLPPWM  240
LSHING*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q3e-22174173Myocyte-specific enhancer factor 2B
1tqe_R3e-22174173Myocyte-specific enhancer factor 2B
1tqe_S3e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.23481e-148flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379907941e-148
Expression AtlasQ10CQ1-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) apical meristem and later in developing stamens, pistil primordia and differentiated anthers.
UniprotTISSUE SPECIFICITY: Highly expressed in sterile lemmas, at intermediate levels in stamens, and weakly in lemmas, paleas and carpels. {ECO:0000269|PubMed:10444103}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|Ref.9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g54160.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q10CQ1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g54160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509350.0FJ750935.1 Oryza sativa clone KCS096F11 MADS-box transcription factor 14 mRNA, complete cds.
GenBankAY3324780.0AY332478.1 Oryza sativa (japonica cultivar-group) MADS box protein (AGL10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631034.10.0PREDICTED: MADS-box transcription factor 14 isoform X2
SwissprotQ10CQ10.0MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBLA0A0E0D6Y10.0A0A0E0D6Y1_9ORYZ; Uncharacterized protein
TrEMBLB8AJY20.0B8AJY2_ORYSI; Putative uncharacterized protein
TrEMBLD3U2G70.0D3U2G7_ORYSA; MADS-box transcription factor 14
STRINGBGIOSGA009798-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.17e-75MIKC_MADS family protein
Publications ? help Back to Top
  1. Moon YH, et al.
    Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
    Plant Physiol., 1999. 120(4): p. 1193-204
    [PMID:10444103]
  2. Kyozuka J,Kobayashi T,Morita M,Shimamoto K
    Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes.
    Plant Cell Physiol., 2000. 41(6): p. 710-8
    [PMID:10945340]
  3. Lim J,Moon YH,An G,Jang SK
    Two rice MADS domain proteins interact with OsMADS1.
    Plant Mol. Biol., 2000. 44(4): p. 513-27
    [PMID:11197326]
  4. Favaro R, et al.
    Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants.
    Mol. Genet. Genomics, 2002. 268(2): p. 152-9
    [PMID:12395189]
  5. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  6. Ryu CH, et al.
    OsMADS50 and OsMADS56 function antagonistically in regulating long day (LD)-dependent flowering in rice.
    Plant Cell Environ., 2009. 32(10): p. 1412-27
    [PMID:19558411]
  7. Ren D, et al.
    MULTI-FLORET SPIKELET1, which encodes an AP2/ERF protein, determines spikelet meristem fate and sterile lemma identity in rice.
    Plant Physiol., 2013. 162(2): p. 872-84
    [PMID:23629832]