PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g53960.2
Common NameADA2, LOC4334126, Os03g0750800, OSJNBa0047E24.21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 568aa    MW: 63551.7 Da    PI: 7.5522
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g53960.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-12111151445
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       W ++E+ ll+++++++G g+W+ +a+++g ++t  qc++++ 
  LOC_Os03g53960.2 111 WNADEEILLLEGIEMYGLGNWAEVAEHVG-TKTKAQCIDHYT 151
                       *****************************.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250242.2E-18637563IPR016827Transcriptional adaptor 2
SMARTSM002911.6E-104792IPR000433Zinc finger, ZZ-type
PfamPF005693.2E-94990IPR000433Zinc finger, ZZ-type
CDDcd023353.05E-265199No hitNo description
PROSITE profilePS5013510.8245194IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.71E-1451114No hitNo description
PROSITE patternPS0135705380IPR000433Zinc finger, ZZ-type
SuperFamilySSF466898.97E-13104157IPR009057Homeodomain-like
PROSITE profilePS5129322.533106158IPR017884SANT domain
SMARTSM007172.4E-11107156IPR001005SANT/Myb domain
PfamPF002492.7E-12110151IPR001005SANT/Myb domain
CDDcd001679.51E-12111152No hitNo description
Gene3DG3DSA:1.10.10.606.8E-9111153IPR009057Homeodomain-like
SuperFamilySSF466891.36E-22464556IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MGRSRGVPNS GDDETNHRSK RRRVASSGDA PDSLSAACGG AGEGGGKKAL YHCNYCNKDI  60
SGKIRIKCSK CPDFDLCVEC FSVGAEVTPH RSNHPYRVMD NLSFPLICPD WNADEEILLL  120
EGIEMYGLGN WAEVAEHVGT KTKAQCIDHY TTAYMNSPCY PLPDMSHVNG KNRKELLAMA  180
KVQGESKKVL PGDLTPKDES PFSPPRVKVE DALGEGLAGR SPSHIAGGAN KKASNVGQFK  240
DGANVAKVED GHVDRSIGVK KPRYSADEGP SLTELSGYNS KRHEFDPEYD NDAEQALAEM  300
EFKETDSETD RELKLRVLRI YLSRLDERKR RKEFILERNL LFPNPLEKDL TNEDKEVYHR  360
YKVFMRFLSK EEHEALVRSV LEERKIRRRI QELQECRSAG CRTLAEAKIH IEQKRKKEHE  420
VNAQKAKESG QLLSNTKVVH KTNRPMKIES DGNLDQKKGG ASLDSTGRDS PKTTGHAGTK  480
HWDDWDIVGF PGAELLSTSE KNLCCQNRLL PNHYLKMQEV LMQEIFKGSV AKKEDAHVLF  540
KVDPAKVDNV YDMVTKKLGT NEEAPTV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11923KRRRV
2327332RKRRKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.592660.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329826200.0
Expression AtlasQ75LL6-
Functional Description ? help Back to Top
Source Description
UniProtRequired for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g53960.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g53960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0725970.0AK072597.1 Oryza sativa Japonica Group cDNA clone:J023128E10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631988.10.0PREDICTED: transcriptional adapter ADA2
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A0E0P1D30.0A0A0E0P1D3_ORYRU; Uncharacterized protein
TrEMBLB8AJW80.0B8AJW8_ORYSI; Putative uncharacterized protein
TrEMBLB9FBU40.0B9FBU4_ORYSJ; Uncharacterized protein
STRINGLOC_Os03g53960.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA009803-PA0.0(Oryza sativa Indica Group)