PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g52239.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 322aa    MW: 33784.6 Da    PI: 6.7955
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g52239.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.7e-101121491954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  LOC_Os03g52239.3 112 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 149
                       664459******************************88 PP

2BELL63.44.9e-211433072
              BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                      +q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  LOC_Os03g52239.3  1 MQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 43
                      9***************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075266.9E-18140IPR006563POX domain
PROSITE profilePS5007112.690153IPR001356Homeobox domain
CDDcd000865.71E-1493154No hitNo description
SMARTSM003891.6E-993157IPR001356Homeobox domain
SuperFamilySSF466897.27E-1894160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-2996159IPR009057Homeodomain-like
PfamPF059201.3E-18110149IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MQMVVNFFDS VMGFGAATPY TALAQKAMSR HFRCLKDAIA AQLRGTCEAL GEKDAGTGSG  60
LTKGETPRLR AIDQSLRQQR AFHHMGIMEQ EAWRPQRGLP ERSVNILRSW LFEHFLHPYP  120
SDADKHLLAR QTGLSRNQVS NWFINARVRL WKPMIEEMYQ QECKELEGSS GAGDDPSGAD  180
DTHSPTTTAA AHHQHRHGQL MVEHGGASSG GGAAMSSHKH EPGVVAGPSS SSAAAVADAA  240
FVGIDPVELL GGDGAAADDL YGRFDPAGAV RVRYGPAGAA AGAAAAAAGD VSLTLGLQHA  300
GAGNAGPDGS GRFSLRDYSG C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-1899157563Homeobox protein Meis2
4xrm_B2e-1899157563Homeobox protein Meis2
5bng_A1e-1899157159Homeobox protein Meis2
5bng_B1e-1899157159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.983700.0leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567640910.0
Expression AtlasQ10DD5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g52239.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g52239
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2874760.0AK287476.1 Oryza sativa Japonica Group cDNA, clone: J043023B19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631398.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-103BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLQ10DD50.0Q10DD5_ORYSJ; Homeodomain protein JUBEL1, putative, expressed
STRINGLOC_Os03g52239.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-97BEL1-like homeodomain 4