PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g52239.2
Common NameLOC9266975, Os03g0732100, OSNPB_030732100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 342aa    MW: 36176.3 Da    PI: 6.7168
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g52239.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.5e-101321691954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  LOC_Os03g52239.2 132 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 169
                       664459******************************88 PP

2BELL92.34.7e-309631872
              BELL 18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                      +Vd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  LOC_Os03g52239.2  9 QVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 63
                      7***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.0E-6161IPR006563POX domain
PfamPF075263.1E-27960IPR006563POX domain
PROSITE profilePS5007112.6110173IPR001356Homeobox domain
CDDcd000867.25E-14113174No hitNo description
SMARTSM003891.6E-9113177IPR001356Homeobox domain
SuperFamilySSF466897.7E-18114180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-29116179IPR009057Homeodomain-like
PfamPF059201.4E-18130169IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MMDGCGSMQV DRRYNHYCDQ MQMVVNFFDS VMGFGAATPY TALAQKAMSR HFRCLKDAIA  60
AQLRGTCEAL GEKDAGTGSG LTKGETPRLR AIDQSLRQQR AFHHMGIMEQ EAWRPQRGLP  120
ERSVNILRSW LFEHFLHPYP SDADKHLLAR QTGLSRNQVS NWFINARVRL WKPMIEEMYQ  180
QECKELEGSS GAGDDPSGAD DTHSPTTTAA AHHQHRHGQL MVEHGGASSG GGAAMSSHKH  240
EPGVVAGPSS SSAAAVADAA FVGIDPVELL GGDGAAADDL YGRFDPAGAV RVRYGPAGAA  300
AGAAAAAAGD VSLTLGLQHA GAGNAGPDGS GRFSLRDYSG C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-18119177563Homeobox protein Meis2
4xrm_B2e-18119177563Homeobox protein Meis2
5bng_A2e-18119177159Homeobox protein Meis2
5bng_B2e-18119177159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.983700.0leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567640910.0
Expression AtlasQ10DD6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g52239.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g52239
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2874760.0AK287476.1 Oryza sativa Japonica Group cDNA, clone: J043023B19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631398.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-113BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A0E0P0V80.0A0A0E0P0V8_ORYRU; Uncharacterized protein
TrEMBLQ10DD60.0Q10DD6_ORYSJ; Homeodomain protein JUBEL1, putative, expressed
STRINGLOC_Os03g52239.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-107BEL1-like homeodomain 4