PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g52239.1
Common NameLOC9266975, Os03g0732100, OSNPB_030732100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 791aa    MW: 81918.6 Da    PI: 6.9481
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g52239.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-095816181954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  LOC_Os03g52239.1 581 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 618
                       564459******************************88 PP

2BELL119.91.2e-38442512272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  LOC_Os03g52239.1 442 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 512
                       779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.2E-69368510IPR006563POX domain
PfamPF075264.1E-53373509IPR006563POX domain
PROSITE profilePS5007112.6559622IPR001356Homeobox domain
CDDcd000864.58E-13562623No hitNo description
SMARTSM003891.6E-9562626IPR001356Homeobox domain
SuperFamilySSF466892.69E-17564629IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28565628IPR009057Homeodomain-like
PfamPF059204.0E-18579618IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 791 aa     Download sequence    Send to blast
MGIAAPPCQP GQTTTFVISQ PTSSKSSPAA IVVRPPATAS SSSMSHSQGF HQPSSGAVFG  60
FSSDGFDGRP GSGQDHQQHE QQQQQHVAQQ SRRDKLRVQG FDPAAAAAGH GLLPIEGDEH  120
GAEPGAMYDH AEAAAAGASN MLSEMFNFPS QPPTGPSATE LLASQMNANY RFGFRQAAGL  180
AGGEGGWFGG GGAAGRTGLV LGGASLGSLG ETSSPKQQAS GMAGLAADPA AAMHLFLMNP  240
QQQQQQQSRS STSPPPSDAQ SAIHQHHEAF QAFGGAGAAA FGGGAAAGVV EGQGLSLSLS  300
PSLQQLEMAK QAEELRVRDG VLYFNRQQQQ QQAAAAAASV QQQLPMALHG QVGVLGQQLH  360
GGGYGGPAGV AGVLRNSKYT RAAQELLEEF CSVGRGQIKG GGGRGSAPNN PNSSKAAASS  420
SGAAQSPSSA SKEPPQLSPA DRFEHQRKKA KLISMLDEVD RRYNHYCDQM QMVVNFFDSV  480
MGFGAATPYT ALAQKAMSRH FRCLKDAIAA QLRGTCEALG EKDAGTGSGL TKGETPRLRA  540
IDQSLRQQRA FHHMGIMEQE AWRPQRGLPE RSVNILRSWL FEHFLHPYPS DADKHLLARQ  600
TGLSRNQVSN WFINARVRLW KPMIEEMYQQ ECKELEGSSG AGDDPSGADD THSPTTTAAA  660
HHQHRHGQLM VEHGGASSGG GAAMSSHKHE PGVVAGPSSS SAAAVADAAF VGIDPVELLG  720
GDGAAADDLY GRFDPAGAVR VRYGPAGAAA GAAAAAAGDV SLTLGLQHAG AGNAGPDGSG  780
RFSLRDYSGC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-17568625158Homeobox protein Meis1
4xrs_B1e-17568625158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.983700.0leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567640910.0
Expression AtlasQ10DD6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g52239.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g52239
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2874760.0AK287476.1 Oryza sativa Japonica Group cDNA, clone: J043023B19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631398.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-140BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLQ10DD60.0Q10DD6_ORYSJ; Homeodomain protein JUBEL1, putative, expressed
STRINGLOC_Os03g52239.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-123BEL1-like homeodomain 4