PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g51970.1
Common NameGRF6, LOC4333990, Os03g0729500, OsJ_12442, OSJNBb0011H13.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 457aa    MW: 49361.8 Da    PI: 7.4784
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g51970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.7e-2476120145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  LOC_Os03g51970.1  76 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 120
                       79****************************************986 PP

2QLQ57.83.2e-201046137
               QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      ++FT++Q+ +L++Q+l+yKyLaan PvP+ Ll +i++
  LOC_Os03g51970.1 10 GPFTPSQWIELEHQALIYKYLAANSPVPHSLLIPIRR 46
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-111046IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.3E-151145IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.0871146IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.45576120IPR014977WRC domain
PfamPF088791.5E-2077119IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MQGAMARVRG PFTPSQWIEL EHQALIYKYL AANSPVPHSL LIPIRRSLTS PYSPAYFGSS  60
TLGWGSFQLG YSGSADPEPG RCRRTDGKKW RCSRDAVADQ KYCERHMNRG RHRSRKHVEG  120
QPGHAAKAMP AAVAAAAASA TQPSAPAAHS GGAVAGLAIN HQHQQMKNYA ANTANPCSLQ  180
YSRDLANKHN ESEQVQDSDS LSMLTSISTR NTGSLFPFSK QHNPFEVSNS RPDFGLVSPD  240
SLMSSPHSSL ENVNLLTSQS LNEQQSSVSL QHFVDWPRTP AQGALAWPDA EDMQAQRSQL  300
SISAPMASSD LSSASTSPIH EKLMLSPLKL SREYSPIGLG FAANRDEVNQ GEANWMPMFR  360
DSLMGGPLGE VLTKNNNMEA RNCLSESLNL LNDGWDSSSG FDSSPVGVLQ KTTFGSVSSS  420
TGSSPRLENH SVYDGNSNLR DDLGSVVVNH PSIRLV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497510.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329836010.0
Expression AtlasQ6AWY3-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g51970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g51970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0735780.0AK073578.1 Oryza sativa Japonica Group cDNA clone:J033048N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628630.10.0PREDICTED: growth-regulating factor 6
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLA0A0D9ZCM10.0A0A0D9ZCM1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0P0T70.0A0A0E0P0T7_ORYRU; Uncharacterized protein
STRINGLOC_Os03g51970.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA013499-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP33571226
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-54growth-regulating factor 1
Publications ? help Back to Top
  1. Ye R,Yao QH,Xu ZH,Xue HW
    Development of an efficient method for the isolation of factors involved in gene transcription during rice embryo development.
    Plant J., 2004. 38(2): p. 348-57
    [PMID:15078336]
  2. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]