PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g51710.1
Common NameHOS13, LOC4333975, Os03g0727200, OSH3, OSJNBa0013A09.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 378aa    MW: 41382.8 Da    PI: 5.8305
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g51710.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox162e-052853192155
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       + ++ps+ e+  LA+++gL+++q+ + F N+R ++
  LOC_Os03g51710.1 285 RWPNPSEMEKIALAESTGLEQKQINNCFINQRKRH 319
                       5689****************************885 PP

2ELK33.11.3e-11240260222
               ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                       LK++LlrKYsgyLg+L++E+s
  LOC_Os03g51710.1 240 LKRHLLRKYSGYLGGLRKELS 260
                       9******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-1671115IPR005540KNOX1
PfamPF037909.7E-1673111IPR005540KNOX1
SMARTSM012565.0E-21125188IPR005541KNOX2
PfamPF037911.3E-11131186IPR005541KNOX2
PROSITE profilePS5121310.109239259IPR005539ELK domain
SMARTSM011885.4E-6239260IPR005539ELK domain
PfamPF037899.1E-8240260IPR005539ELK domain
PROSITE profilePS500719.102259322IPR001356Homeobox domain
SuperFamilySSF466899.84E-16260330IPR009057Homeodomain-like
SMARTSM003892.5E-7261326IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-23264325IPR009057Homeodomain-like
CDDcd000861.00E-7271322No hitNo description
PfamPF059203.2E-11279318IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MEELEGHRGE GRLPPPPPLL PFPKVSVQVY TVPSSSTAAS AAAAGGARQA VAPATRDGGD  60
GGGRAAGVLD DPVKARIVSH PRYHRLLAAF LDCHKVGCPA EAAEEIAAAA RVREARQRAA  120
AAASRMPPAP EDPELDQFMV CSIMKELKLV TEDYCKLLVE CKEELSRPLQ EAEEFLRTVE  180
SELNSINSGP PLTALISESK AGLDSSDDDE HEDGSGMEMM EAAEDEDLGI IDPRSDDKAL  240
KRHLLRKYSG YLGGLRKELS KKRKKGKLPK EARQKLLTWW ELHYRWPNPS EMEKIALAES  300
TGLEQKQINN CFINQRKRHW KPTEEMEFAV MEAYHHQSTD AAAAFYVDVD ARLVGATAAA  360
PASAVYTARP DHGVWRA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1254263LRKELSKKRK
2260264KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.18550.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO51037220.0
Expression AtlasQ948L5-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), as well as in the endosperm. At 3 DAP, expression is down-regulated in the central region and in the center of the ventral region of the embryo, where the shoot subsequently forms, but weakly expressed in other regions until 4 DAP, and then disappears after 4 DAP. During transition between the inflorescence and floral phases, expressed in the inflorescence meristems but not in the floral meristem. {ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:10488233}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10488233}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g51710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g51710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0716630.0AB071663.1 Oryza sativa Japonica Group mRNA for transcription factor OSH3, complete cds, cultivar:Nipponbare.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628822.11e-180PREDICTED: homeobox protein knotted-1-like 7
SwissprotQ948L50.0KNOS7_ORYSJ; Homeobox protein knotted-1-like 7
TrEMBLQ948L41e-177Q948L4_ORYSI; Transcription factor
STRINGLOC_Os03g51710.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP150631819
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.15e-61KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Ito Y,Eiguchi M,Kurata N
    Expression of novel homeobox genes in early embryogenesis in rice.
    Biochim. Biophys. Acta, 1999. 1444(3): p. 445-50
    [PMID:10095070]
  2. Sentoku N, et al.
    Regional expression of the rice KN1-type homeobox gene family during embryo, shoot, and flower development.
    Plant Cell, 1999. 11(9): p. 1651-64
    [PMID:10488233]
  3. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]