PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g51330.1
Common NameLOC4333948, Os03g0723000, OSNPB_030723000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 579aa    MW: 62477.5 Da    PI: 5.9538
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g51330.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3534.5e-1082095783374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       + Ll+c +a ++ d  la a La ++  a+ +gdp +Rla+yf+ AL++rla    ++ +  +++++++  s+e +  +k++++++P+ kf+h
  LOC_Os03g51330.1 209 QSLLSCSRAAAT-DPGLAAAELASVRAAATDAGDPSERLAFYFADALSRRLAC---GTGAPPSAEPDARFASDELTLCYKTLNDACPYSKFAH 297
                       7899**998776.89999999*******************************8...5555555566666669999****************** PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ltaNqaIlea+  ++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++RiTgv sp  g   + +l +t+ rL++fA+ lgv+fef + + + 
  LOC_Os03g51330.1 298 LTANQAILEATGAATKIHIVDFGIVQGIQWAALLQALATRPEGKPtRIRITGVPSPLLGpqPAASLAATNTRLRDFAKLLGVDFEFVP-LLRP 389
                       *****************************************88777*********998888999************************.599* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       +++l+ +++ v+p+Ea+aVn++lql++ll +s +l     +vL+l kslsP vv++ e e+++n++ F++rf++al+yy +lf+sl++ + r+
  LOC_Os03g51330.1 390 VHELNKSDFLVEPDEAVAVNFMLQLYHLLGDSDELVR---RVLRLAKSLSPAVVTLGEYEVSLNRAGFVDRFANALSYYRSLFESLDVAMTRD 479
                       *****************************88888877...***************************************************** PP

              GRAS 279 seerikvErellgreivnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLv 368
                       s er+ vEr ++g++i+ +v   ega+r+er+   ++W+  +e +GF+pvpls++a +qa+lll +++ +  y++ e   +++ l W++rpL+
  LOC_Os03g51330.1 480 SPERVRVERWMFGERIQRAVGpEEGADRTERMAGSSEWQTLMEWCGFEPVPLSNYARSQADLLLWNYDsKYKYSLVELPPAFLsLAWEKRPLL 572
                       ********************8356889*****************************************7778999999999988********* PP

              GRAS 369 svSaWr 374
                       +vSaWr
  LOC_Os03g51330.1 573 TVSAWR 578
                       *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.782181556IPR005202Transcription factor GRAS
PfamPF035141.5E-105209578IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QQQQQQQQQQ RHHHHHHLPP PPPPQSMAPH HHQQKHHHHH  60
QQMPAMPQAP PSSHGQIPGQ LAYGGGAAWP AGEHFFADAF GASAGDAVFS DLAAAADFDS  120
DGWMESLIGD APFQDSDLER LIFTTPPPPV PSPPPTHAAA TATATAATAA PRPEAAPALL  180
PQPAAATPVA CSSPSPSSAD ASCSAPILQS LLSCSRAAAT DPGLAAAELA SVRAAATDAG  240
DPSERLAFYF ADALSRRLAC GTGAPPSAEP DARFASDELT LCYKTLNDAC PYSKFAHLTA  300
NQAILEATGA ATKIHIVDFG IVQGIQWAAL LQALATRPEG KPTRIRITGV PSPLLGPQPA  360
ASLAATNTRL RDFAKLLGVD FEFVPLLRPV HELNKSDFLV EPDEAVAVNF MLQLYHLLGD  420
SDELVRRVLR LAKSLSPAVV TLGEYEVSLN RAGFVDRFAN ALSYYRSLFE SLDVAMTRDS  480
PERVRVERWM FGERIQRAVG PEEGADRTER MAGSSEWQTL MEWCGFEPVP LSNYARSQAD  540
LLLWNYDSKY KYSLVELPPA FLSLAWEKRP LLTVSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.02045781375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.180820.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329868120.0
Expression AtlasQ53K16-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g51330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g51330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1469360.0AC146936.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone B1154F06 map near C10769, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAK1028570.0AK102857.1 Oryza sativa Japonica Group cDNA clone:J033110P03, full insert sequence.
GenBankAK1016030.0AK101603.1 Oryza sativa Japonica Group cDNA clone:J033051K20, full insert sequence.
GenBankAK0640220.0AK064022.1 Oryza sativa Japonica Group cDNA clone:001-125-A04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628849.10.0PREDICTED: scarecrow-like protein 4
TrEMBLA0A0D9YYY50.0A0A0D9YYY5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GT200.0A0A0E0GT20_ORYNI; Uncharacterized protein
TrEMBLA2XLI90.0A2XLI9_ORYSI; Putative uncharacterized protein
TrEMBLQ53K160.0Q53K16_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGBGIOSGA013482-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g51330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP67991519
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-143GRAS family protein