PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g50900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 760aa    MW: 87901 Da    PI: 7.9162
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g50900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR195.18.1e-3041128289
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                       fY +YA++vGFsvr+sks++s+++++i++r+fvCskeg++++++++t k++r+ra  r gC+a+++v++++ g+w+v+kl +eHnH++
  LOC_Os03g50900.1  41 FYMAYASRVGFSVRISKSRRSRNDESIIMRRFVCSKEGFHHKKQTDTGKRKRKRAIIREGCHAMIEVSQKYYGRWVVIKLIKEHNHAV 128
                       9*************************************************************************************97 PP

2FAR1781.8e-24162249290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       fY +YA+++GF+vr++ s++s +++++++r+fvC++eg +  e+++ ++++r+r + r gC+a++++ k++++kw+v+kl l H+Hela
  LOC_Os03g50900.1 162 FYYAYASRMGFDVRIRLSRRSPKDETFVMRRFVCTREGATPCEENE-NRRKRNRGVPREGCQAMFEIVKKDQDKWVVSKLFLAHTHELA 249
                       9****************************************99999.999*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.7E-2741128IPR004330FAR1 DNA binding domain
PfamPF031012.6E-21162249IPR004330FAR1 DNA binding domain
PfamPF105512.4E-14366450IPR018289MULE transposase domain
PfamPF044341.2E-7642680IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.324643681IPR007527Zinc finger, SWIM-type
SMARTSM005757.2E-6656683IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MAFDVNSEPV DMNNTSSKAN LENSEPFVGM EFESEEAAKV FYMAYASRVG FSVRISKSRR  60
SRNDESIIMR RFVCSKEGFH HKKQTDTGKR KRKRAIIREG CHAMIEVSQK YYGRWVVIKL  120
IKEHNHAVAA PSIVRYVAPE EYAQLEPFAG MEFPSYESAQ TFYYAYASRM GFDVRIRLSR  180
RSPKDETFVM RRFVCTREGA TPCEENENRR KRNRGVPREG CQAMFEIVKK DQDKWVVSKL  240
FLAHTHELAN VPNKVHYIQS NSEVVVLAKS SVLRENSIAP TLNSPLADLG RNFEKQATND  300
QEIREPRRNA FGLDDTQKLL GYFKRLNAEN PTFSYAFQVE KNDCLTHAFW ADAKARTSYY  360
YFGDAVTLET SFVENNDLLP LVMFSGVNHH LQREMFGCAL LTDFTEASYI WLFQNWIAAM  420
GSHHPTSLTT VYNEAIGSAI AKIFPQTHHL YFTADILKRS KDILADIYFR HVSFEREFYV  480
CINEPETIEM FELSWKKVLD KYDLHDNSWL QSLYRIRQKW VPVYFKGVFT ADLSASQRPE  540
SLRNIFEKYF NRRTALPVFI SLFEHLMAGW SEREAVEDLA TSFTRPVLRT PSNMMKQVSE  600
IYTTTVFNIL EEEFIGSLGY YISSLDNDGL IAVYSVTKED TEATCRVRYD TSGNIAKCSC  660
CKFESCGILC RHILRVFLAL DVRTIPDVYI LKRWTKEAKN GFVLDECLRY SELHRDALRY  720
AREGSTSGEV FTFAQQTLQV AFAEVVQMKQ ETFSQCTIR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.518100.0callus| flower| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329738260.0
Expression AtlasQ10DV6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g50900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g50900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC0915320.0AC091532.14 Oryza sativa chromosome 3 BAC OSJNBa0078A17 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632988.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
RefseqXP_015632989.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
RefseqXP_015632990.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
RefseqXP_015632991.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
TrEMBLQ10DV60.0Q10DV6_ORYSJ; Transposon protein, putative, unclassified, expressed
STRINGLOC_Os03g50900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-131FAR1-related sequence 5