PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g50310.1
Common NameLOC4333882, Os03g0711100, OSNPB_030711100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 422aa    MW: 45801.5 Da    PI: 6.655
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g50310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.74.3e-071760339
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                      +r C+ + + +++++C  ++ +lC+ C  + H+        H+v
  LOC_Os03g50310.1 17 ARACDGCMRRRARWHCPADDAFLCQACDASVHSAnplarrhHRV 60
                      578*****************************668888886655 PP

2CCT66.29.3e-23338381144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk+a
  LOC_Os03g50310.1 338 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA 381
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.4E-71562IPR000315B-box-type zinc finger
PROSITE profilePS501199.7981562IPR000315B-box-type zinc finger
PfamPF006432.7E-51759IPR000315B-box-type zinc finger
CDDcd000212.75E-111862No hitNo description
PROSITE profilePS5101715.993338380IPR010402CCT domain
PfamPF062031.2E-17338380IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MASAAAATGA ALGARTARAC DGCMRRRARW HCPADDAFLC QACDASVHSA NPLARRHHRV  60
RLPSASSSPA SSPRSAAAPR AGSDDPDAPA WLHGLKRRPR TPRTKPGGGG KHDASAATVA  120
AAAASAVPDL EAEESGIVGD TDHDVGEEDD EDLLYRVPVF DPMLAELYNP VAADDEEQQI  180
EQKPAARVVP FSEPSPEFAS GSVEADGLSG FDVPDMELAS FAADMESLLM GVDEGFDDLG  240
FLDDEKPHVK LDLDMDMDFA SISPAPAPER EERKRKRPEM ILKLDYEGVI DSWARDGASP  300
WFHGERPRFD PSESWPDFPA GSRGGLGAAV TAVTGGEREA RVSRYREKRR TRLFAKKIRY  360
EVRKLNAEKR PRMKGRFVKR AAALPPLPLP RHQHPPPPPP RALPPVPMML APRGAHGRYR  420
F*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194100LKRRPRT
2348364RRTRLFAKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.174870.0leaf| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379901860.0
Expression AtlasQ53RJ0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g50310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g50310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1205630.0AK120563.1 Oryza sativa Japonica Group cDNA clone:J013132M18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628112.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA2XL970.0A2XL97_ORYSI; Putative uncharacterized protein
TrEMBLQ53RJ00.0Q53RJ0_ORYSJ; CCT motif family protein, expressed
STRINGBGIOSGA013431-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g50310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
MonocotsOGMP100042228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-23B-box type zinc finger protein with CCT domain