PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g50110.1
Common NameLOC9266093, Os03g0708800, OSNPB_030708800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GeBP
Protein Properties Length: 376aa    MW: 40024.8 Da    PI: 7.0732
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g50110.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57387.12.3e-2787181297
            DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                       +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+ + +++sql+eK+rrLK+Kf+++++++++g +p+  ++hd+++++l+++
  LOC_Os03g50110.1  87 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPSPYTRSQLSEKLRRLKNKFRGMSARVARGLDPARLAPHDRDVLHLCSR 178
                       79*******************.556878888************************************************************** PP

            DUF573  95 iWg 97 
                       +W+
  LOC_Os03g50110.1 179 LWD 181
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2488181IPR007592Protein of unknown function DUF573
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MASDQTLPVP VSVELPPAAP NPPDPTAPLL PHADDPSAPP AAAAAARKLP VKRRSPPPRP  60
SSPSSSDPAS SDPAAKQQPQ QPPPPFKFQR IWSESDELRF LQGLLGCGAQ GLVFPRDLNV  120
FYDRFSESMP SPYTRSQLSE KLRRLKNKFR GMSARVARGL DPARLAPHDR DVLHLCSRLW  180
DPANAATSPF AAAGDASSGN KRRRAAPRAG PLMPPDPSGD SNSHDYNGGI SAGTPGAFGD  240
GHGGEEMMYL EQESGHFGYH GDVAIAADGS LDGIVKVQPE TLPALPSIGD IAVHSENGNG  300
KAVVPRSNEH HMANAVLDIF EECLREVKAN GITYGANVNG GSELARRWRA QRIDELDVLS  360
RRLRLLVEDA AAAGR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.505270.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ53RK1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g50110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g50110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8338990.0CT833899.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN056B15, full insert sequence.
GenBankAC0871810.0AC087181.9 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone OSJNBa0018H01 map R1538, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628567.10.0PREDICTED: hypermethylated in cancer 1 protein
TrEMBLA0A0E0P0A20.0A0A0E0P0A2_ORYRU; Uncharacterized protein
TrEMBLQ53RK10.0Q53RK1_ORYSJ; Expressed protein
STRINGLOC_Os03g50110.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9800912
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.22e-09DNA-binding storekeeper protein-related transcriptional regulator