PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g49990.1
Common NameGAI, LOC4333860, Os03g0707600, OsJ_12286, OSJNBb0022E02.5, SLR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 626aa    MW: 65406.2 Da    PI: 4.9539
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g49990.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.42.2e-1402416211374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsPi 90 
                       lv++Ll+cAeav+++++++a+al++++ +la+++g +m+++aayf eALa+r++r        ++p +++     ++++a+ l   f+e +P+
  LOC_Os03g49990.1 241 LVHALLACAEAVQQENFAAAEALVKQIPTLAASQGGAMRKVAAYFGEALARRVYR--------FRPADST---LLDAAFADLLhahFYESCPY 322
                       689****************************************************........5565555...3333333333334******* PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                       lkf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++v+f+++ lva
  LOC_Os03g49990.1 323 LKFAHFTANQAILEAFAGCHRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGLVA 415
                       ********************************************************************************************* PP

              GRAS 184 krledleleeL......rvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                        +l+dle+ +L      +       E++aVn+v++lhrll+++++le+    vL +v  ++P++v+vveqea+hns+sFl+rf+e+l+yys++
  LOC_Os03g49990.1 416 ATLADLEPFMLqpegeaD--AneePEVIAVNSVFELHRLLAQPGALEK----VLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTM 502
                       ***********6555442..15579***********************....***************************************** PP

              GRAS 268 fdsleak...........lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdg 348
                       fdsle +           ++    +++++++++lgr+i+nvvacegaer+erhetl++Wr+rl++aGF+pv+l+++a+kqa++ll+ ++ +dg
  LOC_Os03g49990.1 503 FDSLEGGssgqaelsppaAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGFEPVHLGSNAYKQASTLLALFAgGDG 595
                       ****88878888875554444449********************************************************************* PP

              GRAS 349 yrveeesgslvlgWkdrpLvsvSaWr 374
                       yrvee++g+l+lgW++rpL+++SaWr
  LOC_Os03g49990.1 596 YRVEEKEGCLTLGWHTRPLIATSAWR 621
                       *************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120415.1E-3539113IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.7E-3139120No hitNo description
PROSITE profilePS5098566.58215600IPR005202Transcription factor GRAS
PfamPF035147.5E-138241621IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MKREYQEAGG SSGGGSSADM GSCKDKVMAG AAGEEEDVDE LLAALGYKVR SSDMADVAQK  60
LEQLEMAMGM GGVSAPGAAD DGFVSHLATD TVHYNPSDLS SWVESMLSEL NAPLPPIPPA  120
PPAARHASTS STVTGGGGSG FFELPAAADS SSSTYALRPI SLPVVATADP SAADSARDTK  180
RMRTGGGSTS SSSSSSSSLG GGASRGSVVE AAPPATQGAA AANAPAVPVV VVDTQEAGIR  240
LVHALLACAE AVQQENFAAA EALVKQIPTL AASQGGAMRK VAAYFGEALA RRVYRFRPAD  300
STLLDAAFAD LLHAHFYESC PYLKFAHFTA NQAILEAFAG CHRVHVVDFG IKQGMQWPAL  360
LQALALRPGG PPSFRLTGVG PPQPDETDAL QQVGWKLAQF AHTIRVDFQY RGLVAATLAD  420
LEPFMLQPEG EADANEEPEV IAVNSVFELH RLLAQPGALE KVLGTVHAVR PRIVTVVEQE  480
ANHNSGSFLD RFTESLHYYS TMFDSLEGGS SGQAELSPPA AGGGGGTDQV MSEVYLGRQI  540
CNVVACEGAE RTERHETLGQ WRNRLGRAGF EPVHLGSNAY KQASTLLALF AGGDGYRVEE  600
KEGCLTLGWH TRPLIATSAW RVAAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-552416214375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.44940.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO69704710.0
Expression AtlasQ7G7J6-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: At the vegetative stage, it is expressed in rapidly elongating and dividing organs and tissues. At the influorescence or floral stage, it is expressed in the shoot meristems and stamen primordia. {ECO:0000269|PubMed:12834406}.
UniprotTISSUE SPECIFICITY: Expressed in nodes, internodes, leaf sheats of young seedlings and ears of adult plants. Weakly expressed in leaf blade and root. {ECO:0000269|PubMed:10713441}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. In contrast, its overexpression prevents the GA signaling pathway and induces a dwarf phenotype. {ECO:0000269|PubMed:10713441, ECO:0000269|PubMed:11826299}.
Function -- GeneRIF ? help Back to Top
  1. The N-terminal region of SLR1 has two roles in gibberellin (GA)signaling: interaction with GID1 and transactivation activity.
    [PMID: 22429711]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g49990.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated following GA3 but not ABA application. {ECO:0000269|PubMed:10713441}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q7G7J6
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g49990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0877970.0AC087797.5 Oryza sativa chromosome 3 BAC OSJNBb0022E02 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAB2629800.0AB262980.1 Oryza sativa Japonica Group SLR1 gene for DELLA protein, complete cds.
GenBankAB0309560.0AB030956.1 Oryza sativa Japonica Group mRNA for OsGAI, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631543.10.0PREDICTED: DELLA protein SLR1
SwissprotQ7G7J60.0SLR1_ORYSJ; DELLA protein SLR1
TrEMBLI1PEV60.0I1PEV6_ORYGL; Uncharacterized protein
STRINGLOC_Os03g49990.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Ogawa M,Kusano T,Katsumi M,Sano H
    Rice gibberellin-insensitive gene homolog, OsGAI, encodes a nuclear-localized protein capable of gene activation at transcriptional level.
    Gene, 2000. 245(1): p. 21-9
    [PMID:10713441]
  2. Ikeda A, et al.
    slender rice, a constitutive gibberellin response mutant, is caused by a null mutation of the SLR1 gene, an ortholog of the height-regulating gene GAI/RGA/RHT/D8.
    Plant Cell, 2001. 13(5): p. 999-1010
    [PMID:11340177]
  3. Itoh H,Ueguchi-Tanaka M,Sato Y,Ashikari M,Matsuoka M
    The gibberellin signaling pathway is regulated by the appearance and disappearance of SLENDER RICE1 in nuclei.
    Plant Cell, 2002. 14(1): p. 57-70
    [PMID:11826299]
  4. Sasaki A, et al.
    Accumulation of phosphorylated repressor for gibberellin signaling in an F-box mutant.
    Science, 2003. 299(5614): p. 1896-8
    [PMID:12649483]
  5. Kaneko M, et al.
    Where do gibberellin biosynthesis and gibberellin signaling occur in rice plants?
    Plant J., 2003. 35(1): p. 104-15
    [PMID:12834406]
  6. Gomi K, et al.
    GID2, an F-box subunit of the SCF E3 complex, specifically interacts with phosphorylated SLR1 protein and regulates the gibberellin-dependent degradation of SLR1 in rice.
    Plant J., 2004. 37(4): p. 626-34
    [PMID:14756772]
  7. Itoh H, et al.
    Dissection of the phosphorylation of rice DELLA protein, SLENDER RICE1.
    Plant Cell Physiol., 2005. 46(8): p. 1392-9
    [PMID:15979983]
  8. Ueguchi-Tanaka M, et al.
    GIBBERELLIN INSENSITIVE DWARF1 encodes a soluble receptor for gibberellin.
    Nature, 2005. 437(7059): p. 693-8
    [PMID:16193045]
  9. Hirano K, et al.
    The GID1-mediated gibberellin perception mechanism is conserved in the Lycophyte Selaginella moellendorffii but not in the Bryophyte Physcomitrella patens.
    Plant Cell, 2007. 19(10): p. 3058-79
    [PMID:17965273]
  10. Dai C,Xue HW
    Rice early flowering1, a CKI, phosphorylates DELLA protein SLR1 to negatively regulate gibberellin signalling.
    EMBO J., 2010. 29(11): p. 1916-27
    [PMID:20400938]
  11. Hirano K, et al.
    The suppressive function of the rice DELLA protein SLR1 is dependent on its transcriptional activation activity.
    Plant J., 2012. 71(3): p. 443-53
    [PMID:22429711]
  12. Nakamura H, et al.
    Molecular mechanism of strigolactone perception by DWARF14.
    Nat Commun, 2013. 4: p. 2613
    [PMID:24131983]