PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g48970.4
Common NameOs03g0696300, OSNPB_030696300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 247aa    MW: 26606.5 Da    PI: 8.7304
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g48970.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.83.7e-33162218158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq+Rak+e ekk+  ksrkpylheSRh+hA+rR+Rg+gGrF
  LOC_Os03g48970.4 162 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-VKSRKPYLHESRHQHAMRRARGTGGRF 218
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.5E-37160221IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.398161221IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.1E-29163218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.3E-25164186IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860166186IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.3E-25195218IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MESRPGGTNL VEPRGQGALP SGIPIQQPWW TTSAGVGAVS PAVVAPGSGA GISLSGRDGG  60
GDDAAEESSD DSRRSGETKD GSTDQEKHHA TSQMTALASD YLTPFSQLEL NQPIASAAYQ  120
YPDSYYMGMV GPYGPQAMSA QTHFQLPGLT HSRMPLPLEI SEEPVYVNAK QYHGILRRRQ  180
SRAKAELEKK VVKSRKPYLH ESRHQHAMRR ARGTGGRFLN TKKNEDGAPS EKAEPNKELR  240
VSPDPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-22162225265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.79280.0callus| flower| leaf| panicle| root| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329798780.0
Expression AtlasA0A0P0W2B5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g48970.4
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g48970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470120.0EU847012.1 Oryza sativa Japonica Group clone KCS256D08 CCAAT-binding transcription factor mRNA, complete cds.
GenBankAB2880300.0AB288030.1 Oryza sativa Japonica Group OsHAP2D mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0698540.0AK069854.1 Oryza sativa Japonica Group cDNA clone:J023036P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632638.10.0PREDICTED: nuclear transcription factor Y subunit A-9 isoform X2
SwissprotQ945M95e-41NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A0P0W2B51e-175A0A0P0W2B5_ORYSJ; Os03g0696300 protein (Fragment)
TrEMBLQ10EQ41e-175Q10EQ4_ORYSJ; CCAAT-binding transcription factor
STRINGLOC_Os03g48970.11e-174(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-41nuclear factor Y, subunit A9