PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g48450.2
Common NameLOC4333775, Os03g0690600, OsJ_12174, OSJNBa0022C08.1, OSNPB_030690600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 732aa    MW: 82218.8 Da    PI: 6.8803
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g48450.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.41.6e-1183567271374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA+av+++d + a++lL++++++a p+gd  qRla +f+ +L+arla+++s+ly++l +++t+    s+ l+a++l+  ++P+ ++
  LOC_Os03g48450.2 356 LRTLLIHCAQAVAADDRRTANELLKQIRQHAKPNGDGSQRLAYCFADGLEARLAGTGSQLYHKLVAKRTT---ASDMLKAYHLYLAACPFKRL 445
                       6789************************************************************999999...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       sh++ Nq+Il  ++++++vHiiDf+i  G+QWp+L++ L +R++gpp+lRiTg++ p++g   +e++eetg+rLa++Ae++gvpfe++  +a+
  LOC_Os03g48450.2 446 SHFLSNQTILSLTKNASKVHIIDFGIYFGFQWPCLIRRLFKREGGPPKLRITGIDVPQPGfrPTERIEETGQRLAEYAEKIGVPFEYQG-IAS 537
                       ***********************************************************9*****************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e++ +e+L++k++E+++Vn+ ++  +l de+v+++s+r++vL+++++++P ++++   + +++ + F +rf eal ++salfd+le+++pr
  LOC_Os03g48450.2 538 KWETICVEDLNIKKDEVVIVNCLYRFRNLIDETVAIDSPRNRVLNTIRQVNPAIFIHGIVNGSYSVPFFITRFREALFHFSALFDMLETTVPR 630
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       ++ +r+ +Er l+gre+ nv+aceg++r+er et+++W+ r  +aGF + pl+++++ +ak  ++ ++ + + ++e+s++l++gWk+r ++++
  LOC_Os03g48450.2 631 DDAQRALIERDLFGREALNVIACEGSDRVERPETYKQWQVRNLRAGFVQSPLNQDIVLKAKDKVKDIYHKDFVIDEDSEWLLQGWKGRIIYAI 723
                       ********************************************************************888********************** PP

              GRAS 371 SaWr 374
                       S W+
  LOC_Os03g48450.2 724 STWK 727
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.704330707IPR005202Transcription factor GRAS
PfamPF035145.6E-116356727IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MGLDNNFGEL SGMFCGLSYD GYTDHGSQSD YFRFADPQPA IVPQMDAGPS SAASSTASRA  60
AVSSGTDNPE DWEFISDESL NYISRMLMEE DIDEKVSMYQ EESAALRAAA KPFYDILGHK  120
FPPSPDRQLV AWPLDSPSES STSSYPHSLA SSVTSSNISG AVDSSQRRYV GHSEYRSLSG  180
HSSQPPVGPS SDVRNAMETL EDPLISNGRI PEYLFESFPT WDFRRGVDEA QKFLPGSDKV  240
VIDLEAGGVA KRQEAGKAIS LNVSKAEVLK VKKNRQSEDL DVMEGRNSKQ SAFCSDEPDW  300
IEMFDVLLRQ TEKKATDLRK MMRFEASKNS QVAQPKGPSG TRSRGRKPTK KDVVDLRTLL  360
IHCAQAVAAD DRRTANELLK QIRQHAKPNG DGSQRLAYCF ADGLEARLAG TGSQLYHKLV  420
AKRTTASDML KAYHLYLAAC PFKRLSHFLS NQTILSLTKN ASKVHIIDFG IYFGFQWPCL  480
IRRLFKREGG PPKLRITGID VPQPGFRPTE RIEETGQRLA EYAEKIGVPF EYQGIASKWE  540
TICVEDLNIK KDEVVIVNCL YRFRNLIDET VAIDSPRNRV LNTIRQVNPA IFIHGIVNGS  600
YSVPFFITRF REALFHFSAL FDMLETTVPR DDAQRALIER DLFGREALNV IACEGSDRVE  660
RPETYKQWQV RNLRAGFVQS PLNQDIVLKA KDKVKDIYHK DFVIDEDSEW LLQGWKGRII  720
YAISTWKPNN N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-513607278375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.269160.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329870570.0
Expression AtlasQ6AVK7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g48450.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g48450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0972770.0AC097277.6 Oryza sativa chromosome 3 BAC OSJNBa0022C08 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAK1018480.0AK101848.1 Oryza sativa Japonica Group cDNA clone:J033069K04, full insert sequence.
GenBankAK1014020.0AK101402.1 Oryza sativa Japonica Group cDNA clone:J033037F15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630944.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630943.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630942.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630941.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630940.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630939.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630938.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630937.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630936.10.0PREDICTED: scarecrow-like protein 9
TrEMBLQ6AVK70.0Q6AVK7_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGLOC_Os03g48450.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein