PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g47730.1
Common NameOs03g0680700, Os03g47730, OSNPB_030680700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 347aa    MW: 36567.7 Da    PI: 6.3931
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g47730.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.13e-082843162254
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       ++yp+ +e+  LA  +gL+ +q+++WF N R +
  LOC_Os03g47730.1 284 HPYPNDNEKLMLAVATGLSRTQISNWFINARVR 316
                       89*****************************88 PP

2BELL58.22.1e-191422041072
              BELL  10 akLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       akLlsll e++ r+++y  +l+ v +sFe + g g+ + Yt+l  +a+S hF +L+ ai  ++
  LOC_Os03g47730.1 142 AKLLSLLSELESRHEHYFGELRRVSASFEPALGAGATAGYTALMAQAMSHHFGSLRRAILRKL 204
                       8**********************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.2E-1681202IPR006563POX domain
PfamPF075261.2E-2087200IPR006563POX domain
PROSITE profilePS5007111.175257320IPR001356Homeobox domain
CDDcd000863.45E-11260321No hitNo description
SMARTSM003895.4E-9260324IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-25265326IPR009057Homeodomain-like
SuperFamilySSF466896.42E-17266328IPR009057Homeodomain-like
PfamPF059204.9E-17277316IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MVASKQLHSQ RCGGHYCQLH HHRPEEIAGA GAESHRRDGS SGCGGAGPMV VLTLGSGAAA  60
AEDDGGGRSR CCCGAGGAAP ATMVSALRGS RYLLPAQELL REAVSAAAAS ARGGDDDDEA  120
VASFPHDGKS TGIGGGGGGV QAKLLSLLSE LESRHEHYFG ELRRVSASFE PALGAGATAG  180
YTALMAQAMS HHFGSLRRAI LRKLRLHAAA AARTRSALLR LARDAMEEDD EGDGEEEEEV  240
VNRVVRRTKQ AAAARAEQAW RPLRGLPEDA VGVLRAWLFD HFLHPYPNDN EKLMLAVATG  300
LSRTQISNWF INARVRLWKP MVEEMYNDEF DDDDAGSGGG GASSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-17266324563Homeobox protein Meis2
3k2a_B9e-17266324563Homeobox protein Meis2
4xrm_A8e-17266324563Homeobox protein Meis2
4xrm_B8e-17266324563Homeobox protein Meis2
5bng_A7e-17266324159Homeobox protein Meis2
5bng_B7e-17266324159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.491630.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329746830.0
Expression AtlasQ9AYD8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g47730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g47730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0646650.0AK064665.1 Oryza sativa Japonica Group cDNA clone:002-115-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629617.11e-148PREDICTED: BEL1-like homeodomain protein 11
TrEMBLQ9AYD80.0Q9AYD8_ORYSJ; Associated with HOX family protein
STRINGLOC_Os03g47730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.16e-35BEL1-like homeodomain 11