PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g47036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 170aa    MW: 20090 Da    PI: 10.3486
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g47036.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.29.2e-11821152255
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +yps++e++ LA+++gL+++qV++WF N+R ++
  LOC_Os03g47036.1  82 WPYPSEAEKAALAESTGLDKKQVTNWFINQRKRH 115
                       59*****************************985 PP

2ELK361.5e-123454222
               ELK  2 LKhqLlrKYsgyLgsLkqEFs 22
                       +++L++KYsgyL+sL++E+s
  LOC_Os03g47036.1 34 TRRHLMNKYSGYLNSLWTEIS 54
                      69******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011887.1E-53354IPR005539ELK domain
PROSITE profilePS512139.0273353IPR005539ELK domain
PfamPF037899.4E-93554IPR005539ELK domain
PROSITE profilePS5007112.03455118IPR001356Homeobox domain
SuperFamilySSF466892.05E-1857126IPR009057Homeodomain-like
SMARTSM003892.1E-1257122IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-2562119IPR009057Homeodomain-like
CDDcd000861.11E-1164119No hitNo description
PfamPF059202.4E-1775114IPR008422Homeobox KN domain
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MKHEDVSYDY EDEVAGGLPE KSAAFGENEV TTTTRRHLMN KYSGYLNSLW TEISNKKKNS  60
TGHLPRDARH KLLQWWHLHY RWPYPSEAEK AALAESTGLD KKQVTNWFIN QRKRHWKPKP  120
AAAMDAGFLQ MHPRWLNIPV WKYRFLQATL LRRLPMKIIF TNSYDARYK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g47036.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g47036
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0906831e-138AC090683.7 Oryza sativa chromosome 3 BAC OSJNBa0035I24 genomic sequence, complete sequence.
GenBankAP0149591e-138AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629612.15e-95PREDICTED: putative homeobox protein knotted-1-like 5
SwissprotQ75LX97e-97KNOS5_ORYSJ; Putative homeobox protein knotted-1-like 5
TrEMBLA0A0E0NZE41e-122A0A0E0NZE4_ORYRU; Uncharacterized protein
STRINGLOC_Os03g47036.11e-124(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-33KNOTTED-like from Arabidopsis thaliana