PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g47016.1
Common NameLOC4333698, Os03g0673000, Os03g0673100, OSH10, OSJNBa0035I24.12, OSJNBb0113I20.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 156aa    MW: 17095.4 Da    PI: 10.3323
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g47016.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-0965982255
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
                       +yps+ e++ LA+++gL+ +q+ +WF N+R ++
  LOC_Os03g47016.1 65 WPYPSELEKAALAESTGLDAKQINNWFINQRKRH 98
                      69*****************************985 PP

2ELK37.26.4e-131839122
               ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                      ELK +Ll+KYsgyL+sL+ E+s
  LOC_Os03g47016.1 18 ELKSHLLNKYSGYLSSLWRELS 39
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037897.1E-101839IPR005539ELK domain
PROSITE profilePS5121310.3531838IPR005539ELK domain
SMARTSM011884.0E-71839IPR005539ELK domain
PROSITE profilePS5007112.45538101IPR001356Homeobox domain
SuperFamilySSF466893.12E-1939111IPR009057Homeodomain-like
SMARTSM003899.5E-1240105IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.4E-2643102IPR009057Homeodomain-like
CDDcd000869.59E-1347101No hitNo description
PfamPF059202.1E-165897IPR008422Homeobox KN domain
PROSITE patternPS0002707699IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MASAGLPEIT SPCAEDKELK SHLLNKYSGY LSSLWRELSK KKKKGKLPRD ARQKLLHWWQ  60
LHYRWPYPSE LEKAALAEST GLDAKQINNW FINQRKRHWK PTPPAMEYRS LQPAGAASYG  120
GASAGASTSG GGSAVVRGME GQHFTGGGAY PRGDP*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO51037301e-128
Expression AtlasQ75LX7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g47016.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g47016
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126111e-144CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC1163691e-144AC116369.5 Oryza sativa chromosome 3 BAC OSJNBb0113I20 genomic sequence, complete sequence.
GenBankAC0906831e-144AC090683.7 Oryza sativa chromosome 3 BAC OSJNBa0035I24 genomic sequence, complete sequence.
GenBankAP0149591e-144AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628832.11e-111PREDICTED: homeobox protein knotted-1-like 4
SwissprotQ75LX71e-113KNOS4_ORYSJ; Homeobox protein knotted-1-like 4
TrEMBLA0A0E0NZE21e-111A0A0E0NZE2_ORYRU; Uncharacterized protein
TrEMBLB8AP431e-111B8AP43_ORYSI; Putative uncharacterized protein
TrEMBLB9FA861e-111B9FA86_ORYSJ; Uncharacterized protein
STRINGBGIOSGA010073-PA1e-110(Oryza sativa Indica Group)
STRINGLOC_Os03g47016.11e-110(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-43KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Sentoku N, et al.
    Regional expression of the rice KN1-type homeobox gene family during embryo, shoot, and flower development.
    Plant Cell, 1999. 11(9): p. 1651-64
    [PMID:10488233]
  2. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]