PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g44540.1
Common NameLOC4333575, Os03g0647600, OsHAP2H, OSNPB_030647600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 355aa    MW: 37409.9 Da    PI: 8.9102
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g44540.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA964.2e-30173229158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       d+p+YVNaKQy++Il+RR +Rak+++e++l  k+rkpylheSRh+hA+rR+RgsgGrF
  LOC_Os03g44540.1 173 DAPIYVNAKQYEGILRRRRARAKAQRENRL-VKGRKPYLHESRHRHAMRRARGSGGRF 229
                       68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.8E-33171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.01172232IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.6E-23175197IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.6E-27175229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.6E-23206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MLSFKQSHEG FGHVAAAGAG PQQQQQPWWA GSQLLYGEAS PEEAALRDGG QFQVVPGGRA  60
ALDPAAPEPE KTAVPAMPKR GGGGGAPEVL KFSVFSGNLE PGDTGEKNRE HSATIAMQSP  120
LPEYNGHFEL GLGQSMVSPN YPCIDQCYGL MTTYAMKSMS GGRMLLPLNA PADAPIYVNA  180
KQYEGILRRR RARAKAQREN RLVKGRKPYL HESRHRHAMR RARGSGGRFL NTKKEATAAG  240
CGGSSKTPLA SLVSPADVAH RPGSGGRASS LSGSDVSSPG GVMYDHHRHD DADAADHYNS  300
IDHHLRTPFF TPLPIIMDSG GGGGDHASHS AAAVAAPFRW ATAAGDGCCE LLKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A6e-18173231261HAPB protein
4g92_A6e-18173231261HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213222RHRHAMRRAR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.546600.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329916070.0
Expression AtlasQ60DJ8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g44540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g44540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880340.0AB288034.1 Oryza sativa Japonica Group OsHAP2H mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1063980.0AK106398.1 Oryza sativa Japonica Group cDNA clone:002-102-F12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628114.10.0PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLQ60DJ80.0Q60DJ8_ORYSJ; CCAAT-binding transcription factor subunit B family protein, expressed
STRINGLOC_Os03g44540.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP51361122
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.33e-25nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]