PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g43730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 758aa    MW: 83513.2 Da    PI: 8.1587
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g43730.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.47.9e-15460499241
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                       ++k+C+CkkskClk+YCeCfa++++Cse+C+C +C+N+++
  LOC_Os03g43730.1 460 SCKRCSCKKSKCLKLYCECFASKVYCSESCSCRGCFNDHS 499
                       689**********************************987 PP

2TCR49.21.1e-15545583139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++k+gCnCk+s C+kkYCeCf++g+ Cs +C+Ce+CkN+
  LOC_Os03g43730.1 545 RHKRGCNCKRSYCVKKYCECFQSGVGCSMSCRCENCKNS 583
                       589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.8E-16459500IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.816460585IPR005172CRC domain
PfamPF036381.2E-10462497IPR005172CRC domain
SMARTSM011147.8E-15545586IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.0E-11547583IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MGSETNKEGA RGGGQFEVVA TTCEVTIVVG CMKEMSAGQF YCKGEERVDG GAGIKRRGAP  60
QRKGKSPKKV EGKTYKYKGF VIEGCELDST IIMIKSSDLV HIPSIFTPPE VNSQKGSKTS  120
ICIDRSLSQA YHDSPDNASI LPTNLAQRIQ LSSDTLGSDK RHGIAGKTDH ETAQKHAKLS  180
CFDQRCLDKM KQLTSGMNVQ KRDLAKTHND EITACDWDYL GTQYDSSVVP ESDLRFETAE  240
LLLETPKNGD AMPGKSFLPI VEANLENSRR KLFQGSADCY SQSAVDNIHA YCTSRGKEVA  300
TNHVSGILPC PRESQLIPDH HFSDSLEVPS DYMAMNPSAV SQHLRGLHRR SLFNDKVRDP  360
TMGVQSVSNL GASTCATRHR SIPDDNYSKL VGSPVCALPN VDLHLVRMTE EMLAPNTSEM  420
NTHNQGDYSS QATMPTSAGN SGQENPKRKR QKCQNDNVDS CKRCSCKKSK CLKLYCECFA  480
SKVYCSESCS CRGCFNDHSH EETVLSTRNR IESRNPLAFA PKVIRTCGPG LEFGEDSNAT  540
PASSRHKRGC NCKRSYCVKK YCECFQSGVG CSMSCRCENC KNSFGVRKGI ERFETKEIER  600
ADRKMKDHPK EEQSEMDKYH ALCEIWGVRS TENLFTTPSM DSRRAFALFP SECPKSSLTS  660
STRTSSHLHS PTRTDVLLSP FGSYTQMLLG NEASDMLLQQ GDSSCTASLR IASPNKKRVS  720
PLRTGNTLSP TCRKELGLKS IIPPFPSLTG DANSELQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.753870.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977223800.0
Expression AtlasQ10G99-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g43730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g43730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2427500.0AK242750.1 Oryza sativa Japonica Group cDNA, clone: J090050H19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629591.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLQ10G990.0Q10G99_ORYSJ; Tesmin/TSO1-like CXC domain containing protein, expressed
STRINGLOC_Os03g43730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
MonocotsOGMP147741921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-45Tesmin/TSO1-like CXC domain-containing protein