PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g42630.1
Common NameLOC4333488, Os03g0624600, OsJ_11784, OSJNBb0079B16.7, OSNPB_030624600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 324aa    MW: 34848.4 Da    PI: 6.7853
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g42630.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-5551301128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke++
  LOC_Os03g42630.1   5 LPPGFRFHPTDEELVTYYLARKVSDFGFAT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIF 96 
                       79*************************999.89***************999999*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +g+l g+kktLvfy+grapkg kt+Wvmheyrl
  LOC_Os03g42630.1  97 H-GGALAGMKKTLVFYRGRAPKGAKTSWVMHEYRL 130
                       *.*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-653151IPR003441NAC domain
PROSITE profilePS5100560.3775151IPR003441NAC domain
PfamPF023654.5E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLARKVSDF GFATRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHGGA LAGMKKTLVF YRGRAPKGAK  120
TSWVMHEYRL QSKFPYKPAK DEWVVCRVFK KLQCHLAKPR PPHDDVDGDG ASPPEMVDAS  180
SLGELGELDV SSILLGGFAP PSGELCHGGG GGDGFGAHRL HVGAYMSWLQ AAAAANQGMF  240
QWPAATQAGL VGGTVFAAAH KAAGTMPFGG GCSQQQARDV GVSLANVGGG DALFGGAPLA  300
KVDMECGEQA PQLDMDDSTW RAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-57415116165NO APICAL MERISTEM PROTEIN
1ut4_B7e-57415116165NO APICAL MERISTEM PROTEIN
1ut7_A7e-57415116165NO APICAL MERISTEM PROTEIN
1ut7_B7e-57415116165NO APICAL MERISTEM PROTEIN
3swm_A8e-57415119168NAC domain-containing protein 19
3swm_B8e-57415119168NAC domain-containing protein 19
3swm_C8e-57415119168NAC domain-containing protein 19
3swm_D8e-57415119168NAC domain-containing protein 19
3swp_A8e-57415119168NAC domain-containing protein 19
3swp_B8e-57415119168NAC domain-containing protein 19
3swp_C8e-57415119168NAC domain-containing protein 19
3swp_D8e-57415119168NAC domain-containing protein 19
4dul_A7e-57415116165NAC domain-containing protein 19
4dul_B7e-57415116165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.513780.0root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329726930.0
Expression AtlasQ75LG2-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g42630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g42630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0626750.0AK062675.1 Oryza sativa Japonica Group cDNA clone:001-105-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629240.10.0PREDICTED: NAC domain-containing protein 59
TrEMBLQ75LG20.0Q75LG2_ORYSJ; No apical meristem, putative, expressed
STRINGLOC_Os03g42630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-92NAC domain containing protein 58