PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g42230.1
Common NameLOC4333464, Os03g0619600, OsJ_11751, OSJNBa0063J18.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 537aa    MW: 61158.4 Da    PI: 8.4869
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g42230.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.63e-15361171198
                       HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                        +++ +++p kf++++gg+   s t++l++++g  + v++  +k+++++vl+ GW+ Fv+a++++e+D+++F+ +++s+f   v +f+
  LOC_Os03g42230.1  36 DSRRSMIMPCKFVNHFGGD--FSGTIKLQSPNGILYVVEV--TKCKNKTVLRCGWEAFVDAHHIEENDSLLFRCVENSRF--EVLIFD 117
                       45566999*****888999..7779***************..*******************************9988888..888887 PP

2B341.52.3e-132513331798
                       E--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS..SEE..EEEEE- CS
                B3  17 vlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr..sefelvvkvfr 98 
                       v++  +ae h   +++s+t+tl+   ++++W  ++  rk  ++ +l++ W eFvk+n+++e D++vF  +++  ++f+++v+++r
  LOC_Os03g42230.1 251 VISFCYAEVHF--PHKSVTVTLQRpCKSKKWHPRFYKRKDARMNILRGSWVEFVKDNRVQEQDICVFVPTKDarRNFTFTVHLLR 333
                       33333344443..56899******5677*******77888889*************************66442577888887776 PP

3B347.53.3e-154445211090
                       HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                       + ++++l l  +fa++  ++ ++  + ++ +++g++W   +++r + +r ++ +GW +Fv++n+L++gD+++F+++ +++ 
  LOC_Os03g42230.1 444 SASRCQLELGARFAAAVHLPDRR--QTVVLQRRGERWATVMQIRSGTRRLLI-SGWHRFVRDNRLRVGDICLFEFKTHERW 521
                       345599********999888655..3666778*********88888877655.5********************8755444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.12E-2322121IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-1924120IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.95626119IPR003340B3 DNA binding domain
CDDcd100171.13E-1828117No hitNo description
SMARTSM010191.3E-829119IPR003340B3 DNA binding domain
PfamPF023627.0E-1437117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-19226333IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-18227333IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0022234335IPR003340B3 DNA binding domain
CDDcd100171.73E-17234333No hitNo description
PROSITE profilePS5086310.701235335IPR003340B3 DNA binding domain
PfamPF023621.5E-11250333IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.6E-20424527IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.66E-18425528IPR015300DNA-binding pseudobarrel domain
CDDcd100172.63E-15430532No hitNo description
PROSITE profilePS5086311.998435529IPR003340B3 DNA binding domain
SMARTSM010194.5E-4436534IPR003340B3 DNA binding domain
PfamPF023627.0E-13445522IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MAGSGSCMKK SCVCCQKYLE HLDGKMNCFV RRMTADSRRS MIMPCKFVNH FGGDFSGTIK  60
LQSPNGILYV VEVTKCKNKT VLRCGWEAFV DAHHIEENDS LLFRCVENSR FEVLIFDSDD  120
CEKVFSCAGI RNTCKSIQEK SSSSCDDTAE SSESEGFARN QKGSFSHRRK TANLASSSED  180
SGEDSPSEHE SVESGDLETS QEPYVLSRRS YLSEFQKEKV DALIQEIQPE TTAFVAIMRK  240
SNVQLPTPFL VISFCYAEVH FPHKSVTVTL QRPCKSKKWH PRFYKRKDAR MNILRGSWVE  300
FVKDNRVQEQ DICVFVPTKD ARRNFTFTVH LLRVAAAYSW GGTGVDRAGS SLGRTDVKSA  360
SEISIKEEPI DQEENVSSRN RNGVSDESEE DEDSEGPAHP PYIVPCKSHL SRLQKKIVEE  420
KVRSFQSKFP VYVAIMKKSN VERSASRCQL ELGARFAAAV HLPDRRQTVV LQRRGERWAT  480
VMQIRSGTRR LLISGWHRFV RDNRLRVGDI CLFEFKTHER WRLTMAVHAI FREQCC*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379890220.0
Expression AtlasQ6AV22-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g42230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g42230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1193990.0AK119399.1 Oryza sativa Japonica Group cDNA clone:001-132-D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633049.10.0PREDICTED: B3 domain-containing protein Os03g0619600
RefseqXP_015633050.10.0PREDICTED: B3 domain-containing protein Os03g0619600
SwissprotQ6AV220.0Y3196_ORYSJ; B3 domain-containing protein Os03g0619600
TrEMBLI1PDI80.0I1PDI8_ORYGL; Uncharacterized protein
STRINGLOC_Os03g42230.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1136337
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.13e-13B3 family protein