PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g42200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 456aa    MW: 47231.7 Da    PI: 10.8096
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g42200.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.63.6e-3548102559
            zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                         +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ 
  LOC_Os03g42200.1  48 REQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRP 102
                       579*************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.55949103IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3049101IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-225096IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MPGQVMEAAL QQLPASMASG SLLLPPACLQ HPLPAAAAAS GGVGGSSREQ CPRCASHDTK  60
FCYYNNYNTS QPRHFCRACR RYWTLGGSLR NVPIGGSTRK RPRPPVRRPP VHFTAAAAAA  120
AAAAPPHHHH HHHGGPLTPP PATSSSSQQA GLLGSLFALG AAPLLEGRVG VGFDLGLGLP  180
GPGHHHAVAG GGGPAAAVAT SSSSSAAAPL LWPTGLLDSS SNNAETWRMA AGGMWPEFTA  240
AAAQNIRLVI DIGDTTIQVP LNGPTVVQNI GRQAAAAVAG DSSAGGVSEK TGGAGGGGGE  300
EWMQEQDGLL CMRGRRCGRR GGCLPRPRDW FAALLAADPA AAAVTRDQAG KAMLYLIVNT  360
CTFATSLAVL PDAVRRRRRL RVEEGHRVAD HQHDDGRRAV RRGDVRALRR RRLPAHGPFV  420
GTVVAAVTVV VVRCNLALPF RGGDAGHGCS WVSRL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103KRPRP
2396412RRAVRRGDVRALRRRRL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10GP6
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g42200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g42200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1072060.0AC107206.4 Oryza sativa chromosome 3 BAC OSJNBa0063J18 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559674.28e-55PREDICTED: dof zinc finger protein DOF1.7-like
TrEMBLQ10GP60.0Q10GP6_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGLOC_Os03g42200.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP1257544
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-24DOF zinc finger protein 1