PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g41600.1
Common NameOs03g0612400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 308aa    MW: 33077.8 Da    PI: 7.1728
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g41600.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601352.9e-4271061100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++e+reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++ +
  LOC_Os03g41600.1   7 PCAACKLLRRKCTQGCVFAPYFPPDQPAKFANVHKVFGASNVTKLLNDLQPEQREDAVNSLAYEAEARLRDPVYGCVAYISILQLRIKQVRDQ 99 
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       ++ +++e
  LOC_Os03g41600.1 100 IVDARKE 106
                       9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381558.1E-1184307IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.7386107IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-427103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DQPAKFANVH KVFGASNVTK LLNDLQPEQR  60
EDAVNSLAYE AEARLRDPVY GCVAYISILQ LRIKQVRDQI VDARKELAAY IGPTAFAPVV  120
AAAAPHTHYL PPADYHHQQL QAQGGGGGAG MGAAGYAHQV VQHQMAGLQV QNPHPHPHPH  180
HHHHHQQMVN AQHMALVEVA RDQDMLRARQ AGHANAGATV AVEAPGSSSL NADTFDGGPF  240
LLRQQPPSSV QTEPAMALPY HMEPSPPQPS SGHSHDEVSQ QQHHHHHHRH HHTDGSDEGS  300
GGAAPPG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1015830.0flower
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasC7IZM2
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g41600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g41600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1369720.0AC136972.3 Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629364.10.0PREDICTED: LOB domain-containing protein 36
TrEMBLC7IZM20.0C7IZM2_ORYSJ; Os03g0612400 protein (Fragment)
STRINGLOC_Os03g41600.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-60ASYMMETRIC LEAVES 2-like 1