PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g40080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 778aa    MW: 88331.5 Da    PI: 5.627
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g40080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS42.41.1e-13360429170
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                       l++lL++cA+avs ++++la+ +L+ ++++asp+gd  qRla +++  L  rl++++s++y+++ +++ +
  LOC_Os03g40080.1 360 LRTLLINCAQAVSVSNHSLASDILKIIRHHASPTGDDSQRLALCLAYCLDVRLTGTGSQIYHKFITKRRN 429
                       6789**********************************************************99877766 PP

2GRAS212.62.2e-65434663110337
              GRAS 110 ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                        +vHiiDf+i  G+QWp+L+++La+ ++gpp+lRiTg++ pesg     + +++g rLa++A+++++pfe++ + ++++e+l++e+++++++E
  LOC_Os03g40080.1 434 LKVHIIDFGICFGFQWPSLFEELAKIEDGPPKLRITGIELPESGfrPYARSNNIGLRLADYAKTFNIPFEYQHISSNKWEALSPEDFNIEKDE 526
                       58*****************************************999999************************9999**************** PP

              GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                       +l+Vn++++++ l de+ s++s+r++vL++++ ++Pkv+v    + +++ + Fl+rf e +++y +lfd+l++++pr++e+r+ +Er + +  
  LOC_Os03g40080.1 527 VLIVNCIYRIKDLGDETISINSARSRVLNTIRMMKPKVFVQGVLNGSYGVPFFLTRFKEVMYHYNSLFDMLDKNIPRDNETRMIIERDIYQYI 619
                       ****************************************************************************************99999 PP

              GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                         nv+aceg er+er e+++kW+ r  +aG+ ++pl+  ++ + 
  LOC_Os03g40080.1 620 MLNVIACEGPERIERPESYKKWKVRNLKAGLVQLPLNPAIVRET 663
                       9***********************************99888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.806334680IPR005202Transcription factor GRAS
PfamPF035143.9E-11360429IPR005202Transcription factor GRAS
PfamPF035147.6E-63434663IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 778 aa     Download sequence    Send to blast
MSASQNLHRL PEFCVIPATA CSREPGLPRI VIRSNMGSDD NKRFDDFHVI TNGPGSDAYS  60
NEESINLDSY IAPSTSFCSK IYNPQLYVEK GNGTTDWCQT SGGDYPEKSS INSDITLSYI  120
DKILMQEDID DRGNEDTALQ AMEEPFYELL GEKYPAFPQQ QPLCVCDHLQ NLSANTDKSN  180
GHACNTWSVT RMTNISSSMN SNGNFQGFQF PWSLSSITRE TEQFTHHSNR MVVGLKVDGL  240
SISEKPSQDN CSLQIDAHYM RKHPLFEVHD RKSYPCIEDL DLLEGRSNKQ YAIYYDEPIR  300
DEMFDNVLLC SDHKPLDEGV SLSRAMTNNS SKSSQIGQGK TSARRKTTGK RIQKRDVVDL  360
RTLLINCAQA VSVSNHSLAS DILKIIRHHA SPTGDDSQRL ALCLAYCLDV RLTGTGSQIY  420
HKFITKRRNV KDILKVHIID FGICFGFQWP SLFEELAKIE DGPPKLRITG IELPESGFRP  480
YARSNNIGLR LADYAKTFNI PFEYQHISSN KWEALSPEDF NIEKDEVLIV NCIYRIKDLG  540
DETISINSAR SRVLNTIRMM KPKVFVQGVL NGSYGVPFFL TRFKEVMYHY NSLFDMLDKN  600
IPRDNETRMI IERDIYQYIM LNVIACEGPE RIERPESYKK WKVRNLKAGL VQLPLNPAIV  660
RETQDMSSDK ASIRLCLVCY GNILSWPHPP EAEGTYWSGV ESDRVYRDCS LNNRGPLCNG  720
IPFLNGMIPV SDDFYHVSGD TREISCDTYQ VLDDFYHVSG DTYEISDDTY RISGDSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-293646568329GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10H86
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g40080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g40080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1096020.0AC109602.6 Oryza sativa chromosome 3 BAC OSJNBa0087M10 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630113.10.0PREDICTED: scarecrow-like protein 14
TrEMBLQ10H860.0Q10H86_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGLOC_Os03g40080.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1136547
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-115GRAS family protein