PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g38610.1
Common NameLOC107280316, OJ1785_A05.17, OsJ_11551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 250aa    MW: 27536.8 Da    PI: 9.9346
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g38610.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF529.2e-171050242
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                      ri n+ +r  tf kR++g++KKA+EL +LC+++ +++++++
  LOC_Os03g38610.1 10 RIINDAKRRATFKKRLKGLMKKASELATLCNVDTCLMVYGE 50
                      899************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.4E-16160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.801150IPR002100Transcription factor, MADS-box
CDDcd002667.02E-28286No hitNo description
PRINTSPR004045.4E-9323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-24396IPR002100Transcription factor, MADS-box
PfamPF003191.9E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MARNKVKLQR IINDAKRRAT FKKRLKGLMK KASELATLCN VDTCLMVYGE GEAQATVVWP  60
SESEVMRVLE RFKTLPQLDK YKKMTDLEGF IQERINKFQE QLDKVRRDAD ESETKLLLIE  120
ALEGRRPGLE GITIEQLTSL GWLVDARLNI VNDQLQKLHE QGLLPASISL PTMGVLPYTT  180
AGYTVAQEAP IQRGGWLMGV VRGIGSLGYS LFRGSGRSNT AGPSGDMVQP FNIGAGSSLA  240
NQGISFPPK*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ75IC5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g38610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g38610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1333330.0AC133333.5 Oryza sativa chromosome 3 BAC OJ1785_A05 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629573.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLQ75IC50.0Q75IC5_ORYSJ; Putative transcription factor
STRINGLOC_Os03g38610.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-31AGAMOUS-like 80