PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g38210.1
Common NameOSJNBa0083K01.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 523aa    MW: 55458.7 Da    PI: 4.9334
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g38210.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-1756103148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WTt Ed  lv+ v+q+G g+W+++ r+ g+ R++k+c++rw ++l
  LOC_Os03g38210.1  56 KGPWTTAEDAVLVQHVRQHGEGNWNAVQRMTGLLRCGKSCRLRWTNHL 103
                       79******************************99***********996 PP

2Myb_DNA-binding50.93.7e-16109152146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g+++++E++l++++++qlG++ W++ a++++ gRt++++k++w++
  LOC_Os03g38210.1 109 KGSFSPDEELLIAQLHAQLGNK-WARMASHLP-GRTDNEIKNYWNT 152
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.80451103IPR017930Myb domain
SMARTSM007179.2E-1455105IPR001005SANT/Myb domain
SuperFamilySSF466891.95E-2855150IPR009057Homeodomain-like
PfamPF002494.1E-1456103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2157110IPR009057Homeodomain-like
CDDcd001677.61E-1158103No hitNo description
PROSITE profilePS5129422.55104158IPR017930Myb domain
SMARTSM007178.0E-15108156IPR001005SANT/Myb domain
PfamPF002494.2E-15109152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-24111157IPR009057Homeodomain-like
CDDcd001677.84E-11111152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MEEMIKPAPA PASSEEEKEV VATAATGERR HEEATAGREE QEEEEEEEEA PVVLKKGPWT  60
TAEDAVLVQH VRQHGEGNWN AVQRMTGLLR CGKSCRLRWT NHLRPNLKKG SFSPDEELLI  120
AQLHAQLGNK WARMASHLPG RTDNEIKNYW NTRTKRRQRA GLPVYPPDVQ LHLAFAKRCR  180
YDDFSSPLSS PQQSAGSNVL SMDAADAAGA ASSGYTSARP PPLDLAGQLA MGSRPVQLLA  240
ATPFSAPSSP WGKPFARNAQ FFQFPHSSPV SPTTPTGPVQ VHPVTPELSL GYGLHAGDRA  300
RLPPVSPSPG ARAELPSSQL RPSMAPTTAA AAATGGLVGG ALQDHPNAAS LEAMLQELHD  360
AIKIEPPAPP ENRGTEEEGG GGGGNLRGFL HEQIFDKLMP IKSEDFCIVG LHSVLISLQF  420
PGDGKPEVEL KDDIETLFDL IIPATFPAAA PEPAAAATAA SAAPNHSSSV SQHSSDDQDH  480
SNGADVLDLP ILTGGGGGSS EQDDWSLDGA ACQWDNISGG IC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-295415725127MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6F2H1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g38210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g38210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1479620.0AC147962.1 Oryza sativa chromosome 3 BAC OSJNBa0083K01 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629365.10.0PREDICTED: myb-related protein P
TrEMBLQ6F2H10.0Q6F2H1_ORYSJ; Myb-like DNA-binding domain containing protein
STRINGLOC_Os03g38210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.29e-66myb domain protein 101