PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g33012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 478aa    MW: 50954.9 Da    PI: 8.6444
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g33012.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.52.5e-32200256259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dDgynWrKYGqK vkg e+prsYY+Ct+ +Cpvkkkvers+ d+++++i Y+g+Hnh+
  LOC_Os03g33012.1 200 DDGYNWRKYGQKAVKGGEYPRSYYKCTHLSCPVKKKVERSS-DGQITQILYRGQHNHQ 256
                       8****************************************.***************8 PP

2WRKY104.17.3e-33366424159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC vkk++ers++dpk+v++tYeg+H h+
  LOC_Os03g33012.1 366 LDDGYRWRKYGQKVVKGNPHPRSYYKCTYQGCDVKKHIERSSQDPKAVITTYEGKHSHD 424
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-29190258IPR003657WRKY domain
SuperFamilySSF1182905.23E-26194258IPR003657WRKY domain
PROSITE profilePS5081124.593194258IPR003657WRKY domain
SMARTSM007744.4E-34199257IPR003657WRKY domain
PfamPF031062.1E-24200256IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-36353426IPR003657WRKY domain
SuperFamilySSF1182902.35E-29358426IPR003657WRKY domain
PROSITE profilePS5081137.172361426IPR003657WRKY domain
SMARTSM007741.0E-38366425IPR003657WRKY domain
PfamPF031061.6E-25367424IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MAAHEGGGNG ARRPPAPPLL PTLSLPPRSA AGSLFSAESS PGALTLAASL FPDAPSPAFQ  60
GSFTQLLVGA MGYPAASAPA PPSPFPVPHG LSPTAFLGGS PGLFSPTGNF EMSHQQALAQ  120
VTAEAVHSPY SMINQSDFSL PFSSTTTSVL ASQHVNSSAN VSSPREIPTL PSHTDNSNIE  180
STEVSHGFQT TALTEDKPAD DGYNWRKYGQ KAVKGGEYPR SYYKCTHLSC PVKKKVERSS  240
DGQITQILYR GQHNHQRPPK RRSKDGGALL NEADVSPEKE DASTRSEQGS QDYSGKFKAS  300
NDGGPSSSRR GDRGEQISGS SDSNDQGEEE VKVEGRATSD GNANKRHVPA PAQRIIVQTT  360
SEVDLLDDGY RWRKYGQKVV KGNPHPRSYY KCTYQGCDVK KHIERSSQDP KAVITTYEGK  420
HSHDVPAARN SSHSSANANV SSSSNLPHKD RGQRSSCRDG LRNASSVSSL QLKEESG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-38185427578Probable WRKY transcription factor 4
2lex_A4e-38185427578Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256261RPPKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.23530.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2389282380.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g33012.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g33012
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1938020.0AF193802.2 Oryza sativa zinc finger transcription factor WRKY1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633314.10.0PREDICTED: probable WRKY transcription factor 4 isoform X1
SwissprotQ9XI901e-105WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A0D3FKA40.0A0A0D3FKA4_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9Z9E80.0A0A0D9Z9E8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0J1C40.0A0A0E0J1C4_ORYNI; Uncharacterized protein
STRINGLOC_Os03g33012.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.22e-95WRKY DNA-binding protein 4