PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g29970.1
Common NameOsJ_11252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 226aa    MW: 23826.9 Da    PI: 4.5916
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g29970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1855.7e-5823118297
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyv+plk yl+k+re+e
  LOC_Os03g29970.1  23 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKHYLHKFREIE 115
                       89******************************************************************************************* PP

             NF-YB  95 gek 97 
                       ge+
  LOC_Os03g29970.1 116 GER 118
                       *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.1E-5520122IPR009072Histone-fold
SuperFamilySSF471131.95E-4125148IPR009072Histone-fold
PfamPF008087.4E-282892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.1E-205674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.1E-207593No hitNo description
PRINTSPR006158.1E-2094112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MPDSDNDSGG PSNYAGGELS SPREQDRFLP IANVSRIMKK ALPANAKISK DAKETVQECV  60
SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFEDY VDPLKHYLHK FREIEGERAA  120
ASTTGAGTSA ASTTPPQQQH TANAAGGYAG YAAPGAGPGG MMMMMGQPMY GSPPPPPQQQ  180
QQQHHHMAMG GRGGFGHHPG GGGGGSSSSS GHDEDEDEDE DEDED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-4723113292Transcription factor HapC (Eurofung)
4g91_B2e-4723113292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497700.0leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO375426680.0
Expression AtlasA3AJ24-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g29970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g29970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1205290.0AC120529.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone OSJNBa0039N21, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAB2880400.0AB288040.1 Oryza sativa Japonica Group OsHAP3I gene for HAP3 subunit of HAP complex, complete cds.
GenBankAK0602250.0AK060225.1 Oryza sativa Japonica Group cDNA clone:001-002-G06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631006.11e-156PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233107e-70NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA3AJ241e-167A3AJ24_ORYSJ; Uncharacterized protein
STRINGLOC_Os03g29970.11e-166(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-69nuclear factor Y, subunit B3