PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g29760.3
Common NameOs03g29760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 313aa    MW: 34231.1 Da    PI: 9.306
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g29760.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.12.6e-32158214158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep++VNaKQy++Il+RRq+Rakle+++k   k+rkpylheSRh+hA++R+RgsgGrF
  LOC_Os03g29760.3 158 EEPIFVNAKQYNAILRRRQTRAKLEAQNKA-VKGRKPYLHESRHHHAMKRARGSGGRF 214
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-35156217IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.904157217IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-27159214IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-23160182IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860162182IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.2E-23191214IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MIMLLQEMEN HPVQCMAKTN YDFLARNNYP MKQLVQRNSD GDSSPTKSGE SHQEASAVSD  60
SSLNGQHTSP QSDINNNDSC GERDHGTKSV LSLGNTEAAF PPSKFDYNQP FACVSYPYGT  120
DPYYGGVLTG YTSHAFVHPQ ITGAANSRMP LPVDPSVEEP IFVNAKQYNA ILRRRQTRAK  180
LEAQNKAVKG RKPYLHESRH HHAMKRARGS GGRFLTKKEL LEQQQQQQQQ KPPPASAQSP  240
TGRARTSGGA VVLGKNLCPE NSTSCSPSTP TGSEISSISF GGGMLAHQEH ISFASADRHP  300
TMNQNHRVPV MR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21157219163NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.104400.0callus| flower| leaf| panicle| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329816180.0
Expression AtlasQ5KQM8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g29760.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g29760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470110.0EU847011.1 Oryza sativa Japonica Group clone KCS132A05 CCAAT-binding transcription factor mRNA, complete cds.
GenBankAK0621350.0AK062135.1 Oryza sativa Japonica Group cDNA clone:001-045-F05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631980.10.0PREDICTED: nuclear transcription factor Y subunit A-4
TrEMBLQ5KQM80.0Q5KQM8_ORYSJ; CCAAT-box transcription factor complex WHAP3, putative, expressed
STRINGLOC_Os03g29760.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.14e-38nuclear factor Y, subunit A6