PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g29614.1
Common NameLOC4333088, Os03g0410000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 322aa    MW: 34049 Da    PI: 6.624
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g29614.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+ Ed++lv +++++G g W + +++ g++R++k+c++rw++yl
  LOC_Os03g29614.1 14 RGAWTAMEDDILVSYIAKHGEGKWGALPKRAGLKRCGKSCRLRWLNYL 61
                      89********************************************97 PP

2Myb_DNA-binding47.83.4e-1567111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  LOC_Os03g29614.1  67 RGNISGDEEELILRLHTLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111
                       6777889***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.414961IPR017930Myb domain
SuperFamilySSF466892.19E-2712108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002493.5E-151461IPR001005SANT/Myb domain
CDDcd001675.81E-111661No hitNo description
PROSITE profilePS5129423.04862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2365115IPR009057Homeodomain-like
SMARTSM007176.8E-1466114IPR001005SANT/Myb domain
PfamPF002491.6E-1267111IPR001005SANT/Myb domain
CDDcd001671.67E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRKPCCSKE GLNRGAWTAM EDDILVSYIA KHGEGKWGAL PKRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI SGDEEELILR LHTLLGNRWS LIAGRLPGRT DNEIKNYWNS TLSKRVAMQR  120
TAAATSMPAA ATTSSNADAA GAAARRRRSP EPRTVVVSPI RTKALRCNNN SSSGIVVVQQ  180
AGACSHGGRP PESGAPGDAA ADKVATPQAV QQQQQQELAG AEDDDDLPVP AVCIDLDLDD  240
IELGGLDGFL ISPWRGGGHD DGNAAAGAVP NLPMPIGYEL GGAGGGGEAG AVDLEALLGQ  300
LEAEEDDDGD HHHHHHHHHH Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329958920.0
Expression AtlasQ10JS4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g29614.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g29614
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886190.0D88619.1 Oryza sativa mRNA for OSMYB3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629423.10.0PREDICTED: anthocyanin regulatory C1 protein
TrEMBLQ10JS40.0Q10JS4_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os03g29614.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP2000155
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-59MYB family protein