PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g27090.1
Common NameLOC9272330, Os03g0388600, OSJNBa0017N12.27, OSNPB_030388600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 318aa    MW: 33199.4 Da    PI: 8.0923
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g27090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171664148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEde+lv +v q+Gg+ +W++ +++ g++R+ k+c++rw +yl
  LOC_Os03g27090.1 16 KGPWTREEDEKLVAYVDQHGGHgSWRSLPKRAGLNRCCKSCRLRWINYL 64
                      79*******************9*************************97 PP

2Myb_DNA-binding54.52.7e-1770113146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++T+eE++ ++ ++  lG++ W+tIa +++ gRt++++k++w++
  LOC_Os03g27090.1  70 RGNFTPEEEQAIITLHSVLGNK-WSTIATRLP-GRTDNEIKNYWNT 113
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2961164IPR017930Myb domain
SuperFamilySSF466892.25E-2913111IPR009057Homeodomain-like
SMARTSM007171.3E-131566IPR001005SANT/Myb domain
PfamPF002491.0E-141664IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-241771IPR009057Homeodomain-like
CDDcd001671.06E-101864No hitNo description
PROSITE profilePS5129426.74265119IPR017930Myb domain
SMARTSM007174.3E-1669117IPR001005SANT/Myb domain
PfamPF002492.5E-1570113IPR001005SANT/Myb domain
CDDcd001673.29E-1272115No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2772119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRLRPPCCD ESSVKKGPWT REEDEKLVAY VDQHGGHGSW RSLPKRAGLN RCCKSCRLRW  60
INYLRPDIKR GNFTPEEEQA IITLHSVLGN KWSTIATRLP GRTDNEIKNY WNTRLKKRLI  120
GAGIDPATHR ARPRPPAPGD LATALPQLVA LASLAVDLAV GHAAAAGGAW GAANGAVDYQ  180
QADAAAAQLQ CLQHLLLQPQ TTPATSATSG GGGHPTELNA ASSFLTQAVA SYAAAAATPL  240
PSLVVPGGSQ PLELKRWQDH IGGDHVGAVS PFAGAATVTG HHGGGGGGGG EFLPSELTAL  300
LCSANAIDDL QSSNLDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26161197108B-MYB
1mse_C2e-26161194105C-Myb DNA-Binding Domain
1msf_C2e-26161194105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.867590.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977221740.0
Expression AtlasQ75LP7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g27090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g27090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2434280.0AK243428.1 Oryza sativa Japonica Group cDNA, clone: J100067L15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631094.10.0PREDICTED: transcription factor MYB39
SwissprotQ9SZP12e-62MYB4_ARATH; Transcription repressor MYB4
TrEMBLQ75LP70.0Q75LP7_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os03g27090.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP180181010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.25e-65myb domain protein 9