PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g26130.1
Common NameLOC107280380, OSJNBa0013O08.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 308aa    MW: 32479.7 Da    PI: 7.0516
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g26130.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd  l+ +v+++G+g+W++++ + g+ R+ k+c++rw +yl
  LOC_Os03g26130.1 14 KGPWTPEEDMVLASYVQEHGPGNWRAVPPRTGLLRCSKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding43.76.5e-1467112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg ++  E+ l++++ ++lG++ W++Ia++++ +Rt++++k++w+++l
  LOC_Os03g26130.1  67 RGGFSHHEERLILHLQALLGNR-WAAIASYLP-HRTDNDVKNFWNTHL 112
                       7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129422.963965IPR017930Myb domain
SuperFamilySSF466892.94E-2911108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002498.1E-161461IPR001005SANT/Myb domain
CDDcd001674.75E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2265116IPR009057Homeodomain-like
PROSITE profilePS5129418.35666116IPR017930Myb domain
SMARTSM007171.9E-1466114IPR001005SANT/Myb domain
PfamPF002491.9E-1267112IPR001005SANT/Myb domain
CDDcd001673.84E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGRPPCCEKE GVKKGPWTPE EDMVLASYVQ EHGPGNWRAV PPRTGLLRCS KSCRLRWTNY  60
LRPGIRRGGF SHHEERLILH LQALLGNRWA AIASYLPHRT DNDVKNFWNT HLKKKLALTS  120
SSSSPPTPTT PLVARGQWER KLQTDIDLAR RALRDALSVD DAASPAMISS GPPAPAAAAA  180
YALSERNISV MLSGWAAPPP ARKGLSACNP AAATTTPGGA AAESASTAGT SLELTADCCS  240
GGGDSSASNC LPSSMLLACD DGDATATAAG VAPLSAIESW LLLDDSGEPQ LALDEQLLDV  300
ALRNYAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8W389
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g26130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g26130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0847620.0AC084762.8 Oryza sativa chromosome 3 BAC OSJNBa0013O08 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630096.10.0PREDICTED: myb-related protein 306-like
SwissprotP813922e-95MYB06_ANTMA; Myb-related protein 306
TrEMBLQ8W3890.0Q8W389_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os03g26130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.13e-83myb domain protein 94