PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g25550.1
Common NameOs03g0371800, OSNPB_030371800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 399aa    MW: 42129.3 Da    PI: 6.9253
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g25550.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  LOC_Os03g25550.1 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding46.77.4e-1567144147
                       TSSS-HHHHHHHHHHHHHTTTT................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg................................tWktIartmgkgRtlkqcksrwqky 47 
                       rg +++eE++l+++++ +lG++                                +W+ Ia+ ++ gRt++++k++w++y
  LOC_Os03g25550.1  67 RGTFSQEEEDLIIQLHSMLGNKyvlysssthicqslsrsvpsltmaaatatalaRWSQIAAQLP-GRTDNEVKNFWNSY 144
                       899*************************************************************.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.33965IPR017930Myb domain
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
SuperFamilySSF466897.7E-231465IPR009057Homeodomain-like
CDDcd001671.52E-111761No hitNo description
SuperFamilySSF466891.1E-55193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-226587IPR009057Homeodomain-like
PROSITE profilePS5129410.22266149IPR017930Myb domain
SMARTSM007173.4E-1266147IPR001005SANT/Myb domain
PfamPF002491.2E-1267144IPR001005SANT/Myb domain
CDDcd001673.62E-769145No hitNo description
SuperFamilySSF466897.7E-23117146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-22121149IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIQ LHSMLGNKYV LYSSSTHICQ SLSRSVPSLT MAAATATALA  120
RWSQIAAQLP GRTDNEVKNF WNSYIKKKLR DRGIDPATHK PLAADSSATP TNTTAAAASR  180
STATCRAVFS DAELQIPTAA AVQQQQQAPL VGAMQLVDGI KMPLDDYWPA AAAAAAPSSS  240
TTTFSAYHHA LSMQQQAAAG CGAAAAFDMD ALSHCGVVVA PSASSSSTLT SMAGLSPAAA  300
DAAEQSANVA AAAAATTTNL PWLDLGHANP IATMDHYAGV LDELRWSDYF DGAYQAATTA  360
TQGGALQGQC LYDGGGGGGK DVDDAVQFVD VHSLSNWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251114924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10KS8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g25550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g25550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0872200.0AC087220.9 Oryza sativa chromosome 3 BAC OSJNBb0097F01 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629523.11e-179PREDICTED: myb-related protein Zm38-like
TrEMBLQ10KS80.0Q10KS8_ORYSJ; Myb-like DNA-binding domain containing protein
STRINGLOC_Os03g25550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.14e-69myb domain protein 50