PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g21800.2
Common NameLOC4332761, Os03g0336200, RF2b
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 330aa    MW: 35806 Da    PI: 7.046
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g21800.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.8e-10134181552
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                       kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  LOC_Os03g21800.2 134 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 181
                       9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14130194IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599132195IPR004827Basic-leucine zipper domain
PfamPF001701.3E-8134180IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11134185No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-8134188No hitNo description
CDDcd147033.92E-22135184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MQEPKHTDPA AMRGAHHRRA RSEVAFRLPD DLDLGGGGAG AFDEIGSEDD LFSTFMDIEK  60
ISSGPAAAGG SDRDRAAETS SPPRPKHRHS SSVDGSGFFA AARKDAAASL AEVMEAKKAM  120
TPEQLSELAA IDPKRAKRIL ANRQSAARSK ERKARYITEL ERKVQTLQTE ATTLSAQLTL  180
FQRDTTGLSA ENAELKIRLQ AMEQQAQLRD ALNDALKQEL ERLKLATGEM TNSNETYSMG  240
LQHVPYNTPF FPLAQHNAAR QNGGTQLPPQ FQPPRPNVPN HMLSHPNGLQ DIMQQDPLGR  300
LQGLDISKGP LVVKSESSSI SASESSSTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.265380.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329804900.0
Expression AtlasQ6S4P4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in roots, low level in leaf sheath, but not in leaf blade. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g21800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g21800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0704660.0AK070466.1 Oryza sativa Japonica Group cDNA clone:J023052D02, full insert sequence.
GenBankAK0594730.0AK059473.1 Oryza sativa Japonica Group cDNA clone:001-028-E05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632816.10.0PREDICTED: transcription factor RF2b
SwissprotQ6S4P40.0RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0D0520.0A0A0E0D052_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GM270.0A0A0E0GM27_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NUP80.0A0A0E0NUP8_ORYRU; Uncharacterized protein
STRINGLOC_Os03g21800.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-72bZIP family protein
Publications ? help Back to Top
  1. Dai S,Zhang Z,Chen S,Beachy RN
    RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(2): p. 687-92
    [PMID:14704272]