PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g21240.1
Common NameLOC4332726, Os03g0329900, OsJ_10705, PHR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 429aa    MW: 46732.8 Da    PI: 6.615
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g21240.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.63.2e-34216270155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWtpeLHe+Fv+av++LGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  LOC_Os03g21240.1 216 KQRMRWTPELHESFVHAVNKLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 270
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.835213273IPR017930Myb domain
SuperFamilySSF466893.94E-18214270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-31214272IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-25216270IPR006447Myb domain, plants
PfamPF002498.8E-10218269IPR001005SANT/Myb domain
PfamPF143791.7E-25299346IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MSSSLPILPK SLKDIPRSHN TQNILMPGQL PNDSMPLHQS ATQSSISHPR ASVVRSSYSA  60
MLGYAANPID SVSSHEGHFM AAPFISQSSN AEMLQYLCNN NTHGGHTVPT FFPAPACGAP  120
DYMDTITVPD NHTQSGSSTV TSDAAKQNEW WADIMNDDWK DILDATATDS QSKSMAQPSN  180
SAASQPAFNQ STSSHSGDIC PVTSPPPNNS NASASKQRMR WTPELHESFV HAVNKLGGSE  240
KATPKGVLKL MKVDGLTIYH VKSHLQKYRT ARYKPDLSEG KTQEGKTTDE LSLDLKASMD  300
LTEALRLQME VQKRLHEQLE IQRKLQLRIE EQGKYLQKMF EKQCKSSTQS VQDPSSGDTA  360
TPSEPSNSVD KDSEAALDPN RIGDNHPKNS TNVGANLKTA ATESPDSPVI ATDGSELPQE  420
KRRRVHES*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1420424KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.249940.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329735040.0
Expression AtlasQ10LZ1-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout all stages of plant growth. {ECO:0000269|PubMed:26082401}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and fruits (PubMed:18263782). Expressed in the root cap and the root vascular tissues, in the stele of lateral roots, in the mestome sheath cells and the phloem cells of the leaf, in pollen, vascular cylinder of the anther and the veins of the lemma, palea and pistils, and in the xylem and phloem regions of large vascular bundles in node I (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g21240.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g21240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1095100.0AK109510.1 Oryza sativa Japonica Group cDNA clone:002-104-D09, full insert sequence.
GenBankAK0634860.0AK063486.1 Oryza sativa Japonica Group cDNA clone:001-116-C05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632603.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLQ10LZ10.0Q10LZ1_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein, expressed
STRINGLOC_Os03g21240.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-68phosphate starvation response 1
Publications ? help Back to Top
  1. Zhou J, et al.
    OsPHR2 is involved in phosphate-starvation signaling and excessive phosphate accumulation in shoots of plants.
    Plant Physiol., 2008. 146(4): p. 1673-86
    [PMID:18263782]
  2. Guo M, et al.
    Integrative Comparison of the Role of the PHOSPHATE RESPONSE1 Subfamily in Phosphate Signaling and Homeostasis in Rice.
    Plant Physiol., 2015. 168(4): p. 1762-76
    [PMID:26082401]