PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g21060.1
Common NameLOC4332717, NAC58, Os03g0327800, OSJNBb0014I10.5, OSNPB_030327800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 393aa    MW: 42195.6 Da    PI: 8.5836
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g21060.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1739.2e-5491391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+v+yL+++++++++++ ++i++vdiyk++PwdLp+k + +++ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++
  LOC_Os03g21060.1   9 LPPGFRFHPTDEELIVHYLRNRAASSPCPV-SIIADVDIYKFDPWDLPSKENYGDREWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIH 100
                       79****************************.89***************8777899************************************** PP

               NAM  94 sk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+    ++e vg+kk Lvfykgr pkg+kt+W+mheyrl
  LOC_Os03g21060.1 101 SSggaaTNESVGVKKALVFYKGRPPKGTKTNWIMHEYRL 139
                       *977776777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-645173IPR003441NAC domain
PROSITE profilePS5100561.6919173IPR003441NAC domain
PfamPF023652.0E-2710139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MVLSNPAMLP PGFRFHPTDE ELIVHYLRNR AASSPCPVSI IADVDIYKFD PWDLPSKENY  60
GDREWYFFSP RDRKYPNGIR PNRAAGSGYW KATGTDKPIH SSGGAATNES VGVKKALVFY  120
KGRPPKGTKT NWIMHEYRLA AADAHAANTY RPMKFRNTSM RLDDWVLCRI YKKSSHASPL  180
AVPPLSDHEQ DEPCALEENA PLYAPSSSSA ASMILQGAAA GAFPSLHAAA AATQRTAMQK  240
IPSISDLLNE YSLSQLFDDG GAAAAAPLQE MARQPDHHHH QQQQHALFGH PVMNHFIANN  300
SMVQLAHLDP SSSAAASTSA GAVVEPPAVT GKRKRSSDGG EPTIQALPPA AAAAKKPNGS  360
CVGATFQIGS ALQGSSLGLS HQMLLHSNMG MN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-73917717169NAC domain-containing protein 19
4dul_A8e-73917717169NAC domain-containing protein 19
1ut7_B8e-73917717169NO APICAL MERISTEM PROTEIN
1ut7_A8e-73917717169NO APICAL MERISTEM PROTEIN
1ut4_B8e-73917717169NO APICAL MERISTEM PROTEIN
1ut4_A8e-73917717169NO APICAL MERISTEM PROTEIN
3swp_D9e-73917720172NAC domain-containing protein 19
3swp_C9e-73917720172NAC domain-containing protein 19
3swp_B9e-73917720172NAC domain-containing protein 19
3swp_A9e-73917720172NAC domain-containing protein 19
3swm_D9e-73917720172NAC domain-containing protein 19
3swm_C9e-73917720172NAC domain-containing protein 19
3swm_B9e-73917720172NAC domain-containing protein 19
3swm_A9e-73917720172NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.172860.0flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976008550.0
Expression AtlasQ8H7M1-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g21060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g21060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9823130.0JN982313.1 Oryza sativa Japonica Group NAC transcription factor 58 (NAC58) mRNA, complete cds.
GenBankAK2435140.0AK243514.1 Oryza sativa Japonica Group cDNA, clone: J100075D15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632401.10.0PREDICTED: NAC transcription factor ONAC010-like
SwissprotQ8H4S43e-87NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLQ8H7M10.0Q8H7M1_ORYSJ; NAC domain transcription factor, putative, expressed
STRINGLOC_Os03g21060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-85NAC-like, activated by AP3/PI