PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g21030.1
Common NameLOC4332714, NAC39, Os03g0327100, OsJ_10688, OSJNBb0014I10.2, OSNPB_030327100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 359aa    MW: 39199.3 Da    PI: 5.6079
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g21030.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-55211481129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdee+v++yL++k+ +++++   vi +vd++k+ePw+Lp+++k +ekewyfF+++d+ky+tg+r+nrat+sgyWkatgkdke++
  LOC_Os03g21030.1  21 LPPGFRFHPTDEEIVSHYLTPKALNHRFSS-GVIGDVDLNKCEPWHLPAMAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIF 112
                       79*************************999.99***************988999*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       + +g lvg+kktLvfy grap+gekt Wvmhe+rle
  LOC_Os03g21030.1 113 RGRGILVGMKKTLVFYLGRAPRGEKTGWVMHEFRLE 148
                       *********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-6415171IPR003441NAC domain
PROSITE profilePS5100558.4521171IPR003441NAC domain
PfamPF023655.4E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000975Molecular Functionregulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MSEVSVMAEV EETAAAAPLD LPPGFRFHPT DEEIVSHYLT PKALNHRFSS GVIGDVDLNK  60
CEPWHLPAMA KMGEKEWYFF CHKDRKYPTG TRTNRATESG YWKATGKDKE IFRGRGILVG  120
MKKTLVFYLG RAPRGEKTGW VMHEFRLEGK LPSQLPRSAK DQWAVCKVFN KELALAAKNG  180
PMAVTEATAD DAGIERVGSF SFLSDFIDPA ELPPLMDPSF VADIDGVDDA KVSASTSGQA  240
AIAAGFHVAS QVMSYQQVKM EEPLPLPYLH QQPPRMLHSG QYFSLPAVHP GDLTPSAIRR  300
YCKAEQVSGQ TSALSASRDT GLSTDPNAAG CAEISSAPTS QPFPEFDDGI LGLDDFWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-54101729169NAC domain-containing protein 19
3swp_C2e-54101729169NAC domain-containing protein 19
3swp_B2e-54101729169NAC domain-containing protein 19
3swp_A2e-54101729169NAC domain-containing protein 19
3swm_D2e-54101729169NAC domain-containing protein 19
3swm_C2e-54101729169NAC domain-containing protein 19
3swm_B2e-54101729169NAC domain-containing protein 19
3swm_A2e-54101729169NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.72350.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329760070.0
Expression AtlasQ8H7M4-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g21030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g21030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1854450.0JN185445.1 Oryza sativa Japonica Group NAC transcription factor 39 (NAC39) mRNA, complete cds.
GenBankAK0659890.0AK065989.1 Oryza sativa Japonica Group cDNA clone:J013046E14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633121.10.0PREDICTED: NAC domain-containing protein 92
TrEMBLQ8H7M40.0Q8H7M4_ORYSJ; GRAB2 protein, putative, expressed
STRINGLOC_Os03g21030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.25e-92Arabidopsis NAC domain containing protein 87