PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g20910.2
Common NameLOC4332705, Os03g0325600, WOX6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 329aa    MW: 33255.1 Da    PI: 8.3203
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g20910.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.62.9e-1540100257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  LOC_Os03g20910.2  40 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 100
                       89*****************99*************************************997 PP

2Wus_type_Homeobox106.81.3e-3439102265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
   LOC_Os03g20910.2  39 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 102
                        589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-1436108IPR009057Homeodomain-like
PROSITE profilePS5007111.25636101IPR001356Homeobox domain
SMARTSM003891.2E-638105IPR001356Homeobox domain
PfamPF000465.4E-1340100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-840107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEGSSNSPDR QSSGGSPPEE RGGGGSGGGG GRSAAGEPVR SRWTPKPEQI LILESIFNSG  60
MVNPPKDETV RIRKLLERFG AVGDANVFYW FQNRRSRSRR RQRQMQAAAA AAAAAASSSS  120
PSANTSPAAA SAATVQVGLP PGAVVHTMAM GGSACQYEQQ ASSSSSSGST GGSSLGLFAH  180
GAGASGAGGY LQASCGASAS ASSALAPGLM GDVVDSGGSD DLFAISRQMG FVGSPRCSPA  240
SSPATPSSAA TAAQQQFYSC QLPAATITVF INGVPMEMPR GPIDLRAMFG QDVMLVHSTG  300
ALLPVNDYGI LMQSLQIGES YFLVARPP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12031RGGGGSGGGGGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.516480.0callus| flower| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329732800.0
Expression AtlasQ10M29-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g20910.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g20910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0632620.0AK063262.1 Oryza sativa Japonica Group cDNA clone:001-113-A08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629006.10.0PREDICTED: WUSCHEL-related homeobox 6 isoform X2
SwissprotQ10M290.0WOX6_ORYSJ; WUSCHEL-related homeobox 6
TrEMBLA0A0D3FHY90.0A0A0D3FHY9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA010824-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.21e-31WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]