PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g20900.1
Common NameLOC4332704, Os03g0325500, OsJ_10679, OSNPB_030325500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 355aa    MW: 39375.6 Da    PI: 7.6653
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g20900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.71.5e-3447101155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprl+WtpeLHerFveav+qLGG+ekAtPkti++lm+v+gLtl+h+kSHLQkYRl
  LOC_Os03g20900.1  47 KPRLKWTPELHERFVEAVNQLGGPEKATPKTIMRLMGVPGLTLYHLKSHLQKYRL 101
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.87444104IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-3345102IPR009057Homeodomain-like
SuperFamilySSF466896.45E-1846102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-2447102IPR006447Myb domain, plants
PfamPF002499.1E-1149100IPR001005SANT/Myb domain
PfamPF143793.3E-25149195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MYHHQQQLQS HNQLLPSRQS FPSERHLLMQ GGSVSGESGL VLSTDAKPRL KWTPELHERF  60
VEAVNQLGGP EKATPKTIMR LMGVPGLTLY HLKSHLQKYR LSKNLHAQAN AGNVKNALVC  120
TTATEKPSEA NGSPVSHLNL GTQTNKSVHI GEALQMQIEV QRRLHEQLEV QRHLQLRIEA  180
QGKYLQSVLE KAQETLAKQN AGSVGLETAK MELSELVSKV STECLQHAFS GFEIESSQML  240
QGHTMHLGDG SVDSCLTACD GSQKDQDILS ISLSAQKGKE IGCMSFDMHV KERGSEDLFL  300
DKLNRRPSNH PERCERRGGF SMSCQTANLD LNMNDTYDGP KHCKKFDLNG FSWA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.515250.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329854910.0
Expression AtlasQ10M30-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g20900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g20900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1002820.0AK100282.1 Oryza sativa Japonica Group cDNA clone:J023074M06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627784.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLQ10M300.0Q10M30_ORYSJ; Os03g0325500 protein
STRINGBGIOSGA012541-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g20900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.42e-94myb-related protein 1