PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g20780.1
Common NameLOC4332697, Os03g0324200, OsEIL1, OSNPB_030324200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family EIL
Protein Properties Length: 644aa    MW: 71034.6 Da    PI: 4.7025
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g20780.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3509.51.5e-155784641354
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa..tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                       eel++rmw+d+m+lkrlke ++++ +d       + +k ++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+L
  LOC_Os03g20780.1  78 EELERRMWRDRMKLKRLKELQLSRGKDPAGGvvGDPSKPRQSQEQARRKKMSRAQDGILKYMLKMMEVCRAQGFVYGIIPEKGKPVSGASDNL 170
                       8*********************9885555448788999******************************************************* PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHH CS
              EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgel 184
                       r+WWkekv+fdrngpaai+kyqa+n++++ es+l + ++ ++hsl+elqDTtlgSLLsalmqhcdppqrr+plekgv+pPWWPtG+e+ww+el
  LOC_Os03g20780.1 171 RGWWKEKVRFDRNGPAAIAKYQADNAVPGFESELAS-GTGSPHSLQELQDTTLGSLLSALMQHCDPPQRRYPLEKGVPPPWWPTGDEEWWPEL 262
                       **********************************66.******************************************************** PP

                       T--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.....XXXXXXX CS
              EIN3 185 glskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.....slrkqsp 272
                       g++kdqg+ppykkphdlkkawkvsvLtavikhmsp+ie+ir+l+rqsk+lqdkm+ake  ++l+v++qee+++ ++ +  +        +++ 
  LOC_Os03g20780.1 263 GIPKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMSPDIEKIRRLVRQSKCLQDKMTAKEISTWLAVVKQEEELYLKLNPGARppaptGGITSAI 355
                       ******************************************************************************944345442233556 PP

                       XXXXXXXXXXXXXXXXXXX.XXXXXXXXXX.............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX CS
              EIN3 273 kvtlsceqkedvegkkeskikhvqavktta.............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrg 336
                       ++++s++ ++dv++ ++ k  ++ ++k+                               ++++++kr +  +e++ + +++v +tc++ q+++
  LOC_Os03g20780.1 356 SFNASSS-EYDVDVVDDCKGDEAGNQKAVVvadptafnlgaamlndkflmpasmkeeatDVEFIQKRSASGAEPELMLNNRV-YTCHNVQCPH 446
                       6666655.99***77777777777777766888888*****************************************99976.********** PP

                       .XXXXXXXXXXXXXXXXX CS
              EIN3 337 setelifadknsisqney 354
                       s++  +f d+n++++++y
  LOC_Os03g20780.1 447 SDYGYGFLDRNARNSHQY 464
                       ****************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.5E-13278332No hitNo description
Gene3DG3DSA:1.10.3180.102.0E-74207340IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.09E-61211335IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MGGGLVMDQG MMFPGVHNFV DLLQQNGGDK NLGFGALVPQ TSSGEQCVMG EGDLVDPPPE  60
SFPDAGEDDS DDDVEDIEEL ERRMWRDRMK LKRLKELQLS RGKDPAGGVV GDPSKPRQSQ  120
EQARRKKMSR AQDGILKYML KMMEVCRAQG FVYGIIPEKG KPVSGASDNL RGWWKEKVRF  180
DRNGPAAIAK YQADNAVPGF ESELASGTGS PHSLQELQDT TLGSLLSALM QHCDPPQRRY  240
PLEKGVPPPW WPTGDEEWWP ELGIPKDQGP PPYKKPHDLK KAWKVSVLTA VIKHMSPDIE  300
KIRRLVRQSK CLQDKMTAKE ISTWLAVVKQ EEELYLKLNP GARPPAPTGG ITSAISFNAS  360
SSEYDVDVVD DCKGDEAGNQ KAVVVADPTA FNLGAAMLND KFLMPASMKE EATDVEFIQK  420
RSASGAEPEL MLNNRVYTCH NVQCPHSDYG YGFLDRNARN SHQYTCKYND PLQQSTENKP  480
SPPAIFPATY NTPNQALNNL DFGLPMDGQR SITELMNMYD NNFVANKNLS NDNATIMERP  540
NAVNPRIQIE EGFFGQGSGI GGSNGGVFED VNGMMQQPQQ TTPAQQQFFI RDDTPFGNQM  600
GDINGASEFR FGSGFNMSGA VEYPGAMQGQ QKNDGASEFE ELE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-742093401132Protein ETHYLENE INSENSITIVE 3
4zds_B4e-742093401132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.126910.0callus| flower| leaf| panicle| root| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160108180.0
Expression AtlasQ8W3M0-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g20780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g20780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1186740.0AC118674.3 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0093J20, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAB0749710.0AB074971.2 Oryza sativa Japonica Group OsEIL1 mRNA for ethylene-insensitive-3-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629857.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246061e-176EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLQ8W3M00.0Q8W3M0_ORYSJ; ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed
STRINGLOC_Os03g20780.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5631682
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-165EIL family protein
Publications ? help Back to Top
  1. Hiraga S, et al.
    Involvement of two rice ETHYLENE INSENSITIVE3-LIKE genes in wound signaling.
    Mol. Genet. Genomics, 2009. 282(5): p. 517-29
    [PMID:19798512]