PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g20090.1
Common NameLOC4332651, Os03g0315400, OSNPB_030315400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 330aa    MW: 36042.9 Da    PI: 4.5874
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g20090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.28.9e-192269148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd+llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  LOC_Os03g20090.1 22 RGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 69
                      89********************************************97 PP

2Myb_DNA-binding51.81.8e-1675118146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  LOC_Os03g20090.1  75 RGNITPQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 118
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3571769IPR017930Myb domain
SuperFamilySSF466895.86E-3120116IPR009057Homeodomain-like
SMARTSM007171.1E-152171IPR001005SANT/Myb domain
PfamPF002496.2E-172269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-232376IPR009057Homeodomain-like
CDDcd001675.28E-122469No hitNo description
PROSITE profilePS5129423.58170124IPR017930Myb domain
SMARTSM007176.2E-1574122IPR001005SANT/Myb domain
PfamPF002492.2E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2377123IPR009057Homeodomain-like
CDDcd001672.59E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDMAHERDAS SEEEVMGGDL RRGPWTVEED LLLVNYIAAH GEGRWNSLAR SAGLKRTGKS  60
CRLRWLNYLR PDLRRGNITP QEQLLILELH SRWGNRWSKI AQHLPGRTDN EIKNYWRTRV  120
QKHAKQLKCD VNSQQFKDVM RYLWMPRLVE RIQAAAAGQQ QQQEGGTDTP PLSWQHGGSD  180
GLYESPELPA PDASCWPAEY CAAAGGAQSG GTPAPELSST TAGSSSLSTD SGAGAQPSWP  240
TQADGAEWFT TACDASSATG GVAMRDTELE LAQPPCQGGQ TWTTSESSLP GLTFPDLAVA  300
DFEIGGFDVD SFWTSMEDDQ LWCPTQAAV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251312218126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.496190.0leaf| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166420920.0
Expression AtlasQ10MB4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g20090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g20090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1205510.0AK120551.1 Oryza sativa Japonica Group cDNA clone:J013130B13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628446.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLQ10MB40.0Q10MB4_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os03g20090.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-83myb domain protein 112