PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g19370.1
Common NameLOC4332602, Os03g0306700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 174aa    MW: 18991.7 Da    PI: 6.5345
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g19370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.44.7e-112382362
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                      e +   rk +NR++A+rsR +K+++++ L+ ++++L  eN+a++  +    + +  +++e
  LOC_Os03g19370.1 23 EERQRNRKRSNRLSAQRSRIKKQQYVDGLAVEAEQLRRENDAMRAGAGAVLQRCRLVEQE 82
                      445556888***********************************9887777777666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.8E-102067No hitNo description
SMARTSM003385.2E-112085IPR004827Basic-leucine zipper domain
PfamPF001707.5E-82271IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.6112366IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.73E-82575No hitNo description
CDDcd147027.71E-142677No hitNo description
PROSITE patternPS0003602943IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSVAPATEGS ARRSAAAAAA EEEERQRNRK RSNRLSAQRS RIKKQQYVDG LAVEAEQLRR  60
ENDAMRAGAG AVLQRCRLVE QENRVLAAHA RELCSALQLR ASQLRLLGEV AGVPLDVPDV  120
ADHLVQLYGG DLGMTPLSPP PLLPPLPPQI EMLYFQPDSV MDPVSMLQGY ENI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.563650.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329951380.0
Expression AtlasQ10MJ6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g19370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g19370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1347690.0AC134769.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OJ1145F05, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAK1099290.0AK109929.1 Oryza sativa Japonica Group cDNA clone:002-151-H09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631799.11e-121PREDICTED: ocs element-binding factor 1
TrEMBLQ10MJ61e-121Q10MJ6_ORYSJ; BZIP transcription factor family protein, expressed
STRINGLOC_Os03g19370.11e-120(Oryza sativa Japonica Group)
STRINGLOC_Os03g19375.11e-120(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1197246
MonocotsOGMP125042837
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.19e-07basic leucine-zipper 44