PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g18480.1
Common NameLOC9267500, Os03g0296000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 307aa    MW: 32350.1 Da    PI: 5.7602
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g18480.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.4e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +l+ +   +G+g+W++++++ g++R++k+c++r+ +yl
  LOC_Os03g18480.1 14 KGPWTAEEDAKLLAYTSTHGTGNWTSVPQRAGLKRCGKSCRLRYTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding53.55.4e-1769110346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T+eE+el+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  LOC_Os03g18480.1  69 NFTQEEEELIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 110
                       89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-24565IPR009057Homeodomain-like
PROSITE profilePS5129416.937961IPR017930Myb domain
SuperFamilySSF466892.9E-3011108IPR009057Homeodomain-like
SMARTSM007174.2E-141363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
CDDcd001673.92E-111661No hitNo description
PROSITE profilePS5129425.00362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2366116IPR009057Homeodomain-like
SMARTSM007173.5E-1566114IPR001005SANT/Myb domain
CDDcd001671.32E-1269112No hitNo description
PfamPF002493.4E-1569110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTAE EDAKLLAYTS THGTGNWTSV PQRAGLKRCG KSCRLRYTNY  60
LRPNLKHENF TQEEEELIVT LHAMLGSRWS LIANQLPGRT DNDVKNYWNT KLSKKLRQRG  120
IDPITHRPIA DLMQSIGTLA IRPPPAAGAA PPPCLPVFHD APYFAALQHQ HQQQQVVTHV  180
DADAPASPDS QHLQLNWSDF LADDAAGHGA DAPAPQAALG QYQEGSAPAA TAVVGGGRAF  240
GDVDGASAGV GAGTDDGAGA ASAFIDAILD CDKEMGVDQL IAEMLADPAY YGGGGGSSSS  300
ELGWGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27141167108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10MT5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g18480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g18480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1186700.0AC118670.2 Genomic sequence for Oryza sativa, Nipponbare stain, clone OSJNBb0036D03, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630216.10.0PREDICTED: transcription factor MYB35
TrEMBLI1PAE00.0I1PAE0_ORYGL; Uncharacterized protein
TrEMBLQ10MT50.0Q10MT5_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os03g18480.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0133600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP118743439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.17e-66myb domain protein 103