PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g17810.1
Common NameLOC4332483, Os03g0287400, OsJ_10424, OSNPB_030287400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 240aa    MW: 25556.8 Da    PI: 6.4936
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g17810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.4e-40631621100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCkvlrr+Ca++Cvlapyfp ++p kf  +h++FGasn++kll++lpe+ r da+ss+vyeAear+rdPvyG++g + +lq++ ++lk++
  LOC_Os03g17810.1  63 PCAACKVLRRRCADGCVLAPYFPPTEPTKFTTAHRVFGASNIIKLLQELPESARADAVSSMVYEAEARLRDPVYGCAGAVCRLQKEANELKVQ 155
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++ 
  LOC_Os03g17810.1 156 LARAQAD 162
                       **99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.27462163IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4063160IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDHAGNTVAN VTVAQQPHYG RSVSPPSRVS SCSPPPPPVG TASLLVGNTS SSSSPTTTVV  60
LSPCAACKVL RRRCADGCVL APYFPPTEPT KFTTAHRVFG ASNIIKLLQE LPESARADAV  120
SSMVYEAEAR LRDPVYGCAG AVCRLQKEAN ELKVQLARAQ ADLLNARAQH DNLVALVCVE  180
LAHRRRDDDQ QLEYQAPAPP LPHPAEYCSG GAGFGATVYQ PFYDSDLDSA AWGEPQLWT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.534140.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166323390.0
Expression AtlasQ10N09-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g17810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g17810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0725150.0AK072515.1 Oryza sativa Japonica Group cDNA clone:J023131K07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629326.11e-176PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR02e-61LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0E0GKZ61e-176A0A0E0GKZ6_ORYNI; Uncharacterized protein
TrEMBLI1PA851e-176I1PA85_ORYGL; Uncharacterized protein
TrEMBLQ10N091e-176Q10N09_ORYSJ; LOB domain protein 1, putative, expressed
STRINGBGIOSGA038947-PA1e-176(Oryza sativa Indica Group)
STRINGLOC_Os03g17810.11e-176(Oryza sativa Japonica Group)
STRINGORGLA03G0128100.11e-176(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-59LOB domain-containing protein 1