PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g16850.1
Common NameLOC107280245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 404aa    MW: 40793.1 Da    PI: 9.6676
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g16850.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-3987146261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       +e alkcprCdstntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+s
  LOC_Os03g16850.1  87 PEPALKCPRCDSTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGSLRNVPVGGGCRRNKRS 146
                       67899*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3671145IPR003851Zinc finger, Dof-type
PfamPF027016.6E-3390145IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.75891145IPR003851Zinc finger, Dof-type
PROSITE patternPS01361093129IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MVFPSVPAYL DPPNWNNQQG QPPRPANVGG GDAQHLPVGP TAAAAAPGEI GGLPTSSSSA  60
SAAAAAAQQA RPNSMAERAR LARAPQPEPA LKCPRCDSTN TKFCYYNNYS LSQPRHFCKT  120
CRRYWTRGGS LRNVPVGGGC RRNKRSGKSS SAAAAGASSS SSKPSSSAAR QLPGGGASPM  180
PSAAASTQPG GAAAGAIIPP SGLSSMSHHL PFLGAMHPPG PNLGLTFSAG FQPLGGMHHH  240
VDTADQFPVA SGGGATIGAS LEQWRVQQQQ QQQPQQHQFP FLGGALELPP PPPMYQLGLE  300
ATRAAGTGAT AAAAFTLGQT SATATTSRQE GSMKLEDSKG LEMSLQRQYM AALRQGDGVW  360
GNNNGGNGGS DGGGNGGGGS WTMNFPGFHS SSGGGGDDGG GVL*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10NB0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g16850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g16850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1376980.0AC137698.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0014A21, from chromosome 3, complete sequence.
GenBankAC0839420.0AC083942.8 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0002D01, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629100.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
TrEMBLQ10NB00.0Q10NB0_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGLOC_Os03g16850.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.33e-42OBF-binding protein 3