PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g15680.1
Common NameLOC107276070, OJ1041F02.13, Os03g0263300, OSNPB_030263300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 576aa    MW: 60848.2 Da    PI: 4.8566
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g15680.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.66.5e-911325251373
              GRAS   1 lvelLlecAeavss..gdlelaqalLarlselaspdgd......pmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklf 84 
                       l +lL+++Aea+s   ++ ela+ +L rl+e++s +++      +m+Rlaa+ft AL+  l +s +   +  ++ ++++++   ++l+a++++
  LOC_Os03g15680.1 132 LLHLLMAAAEALSGphKSRELARVILVRLKEMVSHTASanaaasNMERLAAHFTDALQGLLDGSHPVGGSGRQAAAAASHHhAGDVLTAFQML 224
                       579**********8557777***********96665544455559******************888777766555554444499********* PP

              GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvp 175
                       +++sP++kf+h+taNqaIleav+g++rvHi+D+di +G+QW++L+qa++sR+   ++p+lRiT+v+++  g +++++e g+rL+ fA+++g p
  LOC_Os03g15680.1 225 QDMSPYMKFGHFTANQAILEAVSGDRRVHIVDYDIAEGIQWASLMQAMTSRAdgVPAPHLRITAVSRSGGGGARAVQEAGRRLSAFAASIGQP 317
                       ****************************************************666789*********7777********************** PP

              GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnse............sFle 255
                       f+f     ++ e +++ + r+ +gEal+ n+vl+                 ++L+ +  l +k+v+vve+e + ++              F++
  LOC_Os03g15680.1 318 FSFGQCRLDSDERFRPATVRMVKGEALVANCVLHQAAATTTIRRP-TgSVASFLSGMAALGAKLVTVVEEEGEAEKDddgdsagdaaagGFVR 409
                       *****9999***********************9655554333333.247889*******************988655579999999*99**** PP

              GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                       +f+e l+ ysa+ dslea++p++s+ r  vEr++l+++i  +v+ + +    + e    W ++++ +GF++vpls ++ +qa+lll  ++ dg
  LOC_Os03g15680.1 410 QFMEELHRYSAVWDSLEAGFPTQSRVRGLVERVILAPNIAGAVSRAYRG--VDGEGRCGWGQWMRGSGFTAVPLSCFNHSQARLLLGLFN-DG 499
                       ********************************************99887..88899999*******************************.** PP

              GRAS 349 yrveee.sgslvlgWkdrpLvsvSaW 373
                       y+vee   + +vlgWk r+L+s+S+W
  LOC_Os03g15680.1 500 YTVEETgPNKIVLGWKARRLMSASVW 525
                       ****99457788************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.673106506IPR005202Transcription factor GRAS
PfamPF035142.2E-88132525IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MEVTMEDVAG DFEFSGCGST TTTSSASSLD DGTGMCYAWG ELSPVADWAN FCCSDDDGGH  60
DLHGLIESML CDDTLVGVDD DGQAGLHHAD MFRDDLYCYG NGSNPSSTTT TNPGSPVFDD  120
PTQGCPEKGL RLLHLLMAAA EALSGPHKSR ELARVILVRL KEMVSHTASA NAAASNMERL  180
AAHFTDALQG LLDGSHPVGG SGRQAAAAAS HHHAGDVLTA FQMLQDMSPY MKFGHFTANQ  240
AILEAVSGDR RVHIVDYDIA EGIQWASLMQ AMTSRADGVP APHLRITAVS RSGGGGARAV  300
QEAGRRLSAF AASIGQPFSF GQCRLDSDER FRPATVRMVK GEALVANCVL HQAAATTTIR  360
RPTGSVASFL SGMAALGAKL VTVVEEEGEA EKDDDGDSAG DAAAGGFVRQ FMEELHRYSA  420
VWDSLEAGFP TQSRVRGLVE RVILAPNIAG AVSRAYRGVD GEGRCGWGQW MRGSGFTAVP  480
LSCFNHSQAR LLLGLFNDGY TVEETGPNKI VLGWKARRLM SASVWAPPPL PVPSSPPEGV  540
CQPVVGMAPV ATGGFARTEF DYIDSFLVEP AYALV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3716252525374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ84Q92
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g15680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g15680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1352060.0AC135206.3 Oryza sativa Japonica Group chromosome 3 clone OJ1041F02, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630025.10.0PREDICTED: nodulation-signaling pathway 2 protein-like
SwissprotQ5NE241e-153NSP2_MEDTR; Nodulation-signaling pathway 2 protein
TrEMBLQ84Q920.0Q84Q92_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os03g15680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP68391319
MonocotsOGMP75803148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-96GRAS family protein