PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g14850.1
Common NameOs03g0253400, OsJ_36636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 186aa    MW: 20579.8 Da    PI: 10.0461
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g14850.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.58.1e-142057643
                      HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
            SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                      k  r   fskR ++i+ KA+EL +LC++ vav+ +s++
  LOC_Os03g14850.1 20 KKVRDACFSKRHTTIFNKANELAILCGVMVAVVFVSPN 57
                      6678999*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-10868IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.489857IPR002100Transcription factor, MADS-box
CDDcd002661.59E-17969No hitNo description
SuperFamilySSF554558.76E-15986IPR002100Transcription factor, MADS-box
PfamPF003193.0E-151965IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MVKCRARTTR KKIEIKRGDK KVRDACFSKR HTTIFNKANE LAILCGVMVA VVFVSPNANG  60
GIFSFGYPSV SSVANRFLAN APNNTSVSSS TQSGRDVEIR ELEREERELK EHLQASTDQN  120
KLLREAIAAR DGGQLMLLLQ SDCSELGPKG LVAVVRLWFR NSLVGIGLDR LCWLLQQILF  180
GLDWG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.818352e-99panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10NZ5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g14850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g14850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1342400.0AC134240.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBb0081I10, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651224.14e-66PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLQ10NZ51e-134Q10NZ5_ORYSJ; Os03g0253400 protein
STRINGLOC_Os03g14850.11e-134(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP2042088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-13AGAMOUS-like 62