PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g13790.1
Common NameLOC4332208, Os03g0241100, OsJ_10091, OSNPB_030241100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 720aa    MW: 78737.2 Da    PI: 6.6052
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g13790.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.71.3e-081456347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +WT +E++ + +a +q G++ +++I  +++  ++  q++++++ +
  LOC_Os03g13790.1 14 AWTRQEEQNFFNALRQVGKN-FEKITLRVQ-SKSKDQVRHYYYRL 56
                      6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-91060IPR009057Homeodomain-like
PROSITE profilePS5129313.1551061IPR017884SANT domain
SMARTSM007175.2E-71159IPR001005SANT/Myb domain
PfamPF002493.5E-71456IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-51463IPR009057Homeodomain-like
CDDcd001671.06E-61457No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
MSLVRSAPAR QWAAWTRQEE QNFFNALRQV GKNFEKITLR VQSKSKDQVR HYYYRLVRRM  60
KKLLGPEFSL DAKNSKDTIA AMLCWWSLLE KFSCSASKLH LKPRRFKTFV EALGNQLLKD  120
RNKTRKKCPR GDVCLSSSSS AVNRTPGNES FSVKLLAVDV SNGSKVGSSK GSFFKKVTEP  180
NCSNKSGATK GDLSATRTVK QKRRAGGVVA SAAYKKWERA AMAGVSLVAD AAEELERNTV  240
NADARMLSPS SSNACTVDGL GTNHIKEADQ QAPAKLKLQL FPINEATRKA LEKDEHNPHL  300
ELTLSARKKI SSVLEHLNRK WGNSNIASGE LLLFPYCAHQ EDLATYQRWT TKDTVAVADV  360
FLSVNSPSVF RLRYGWFSLA ELEAGVSEIS LTHFENCLIP EDIHAKSPLE ACVQKDGNSL  420
SSCAPEQHPC GSKDQSALLF AMPSSTGKSA QVPEQCIDVL PSQFGRQNQD QVTTNQVFEV  480
DQGMDCAAVS EGEWADTLTD ISVGYLLTEA SRGANTDCPG TSVVKNTLLL ENPCSYDSFD  540
AAVALHASRY KSAEQPALAS HSTIWGAEET CDAFSFNLPA SRKREGSNNS ASSSPDSDSD  600
VHPSNSEGFQ CFLQDLAGAA VAHNPCIDDA KDVESLCAES PPRSDHDSAP KDQSLADLYW  660
PDSLGPLDLD IPSATYHADD LLLGDSQNSW NRMMANSLDA FRNLSFFTAD KNDSIPSIM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.146930.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329882380.0
Expression AtlasQ10PA6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g13790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g13790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1026880.0AK102688.1 Oryza sativa Japonica Group cDNA clone:J033102O16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632626.10.0PREDICTED: TSL-kinase interacting protein 1
RefseqXP_015632627.10.0PREDICTED: TSL-kinase interacting protein 1
TrEMBLA0A0E0NS910.0A0A0E0NS91_ORYRU; Uncharacterized protein
TrEMBLQ10PA60.0Q10PA6_ORYSJ; Myb family transcription factor, putative, expressed
STRINGLOC_Os03g13790.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21641015
MonocotsOGMP54783643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.21e-165TSL-kinase interacting protein 1