PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g12350.1
Common NameLOC4332111, ORR1, Os03g0224200, OsJ_09978, OSJNBa0081P02.4, RR21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 692aa    MW: 73807 Da    PI: 6.5106
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g12350.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.92.2e-28202255155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kpr++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  LOC_Os03g12350.1 202 KPRVVWSVELHQQFVNAVNHL-GIDKAVPKKILELMNVPGLTRENVASHLQKFRL 255
                       79*******************.********************************8 PP

2Response_reg77.83.8e-26181261109
                       EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
      Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                       vl+vdD+p+ + +l+++l + +y +++++++++ al++l+e++  +D+i+ D+ mp+mdG++ll+     e++lp+i+++a +  + + + +k
  LOC_Os03g12350.1  18 VLVVDDDPTCLAVLKRMLLECRY-DATTCSQATRALTMLRENRrgFDVIISDVHMPDMDGFRLLELVGL-EMDLPVIMMSADSRTDIVMKGIK 108
                       89*********************.***************99999********************87754.558******************** PP

                       TTESEEEESS--HHHHHH CS
      Response_reg  92 aGakdflsKpfdpeelvk 109
                        Ga d+l Kp+ +eel +
  LOC_Os03g12350.1 109 HGACDYLIKPVRMEELKN 126
                       ***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.6E-1991674IPR017053Response regulator B-type, plant
SuperFamilySSF521724.27E-3615143IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.8E-4215151No hitNo description
SMARTSM004489.4E-3016128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.99317132IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.9E-2318126IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.00E-2719132No hitNo description
Gene3DG3DSA:1.10.10.601.1E-29199260IPR009057Homeodomain-like
SuperFamilySSF466899.32E-20199259IPR009057Homeodomain-like
PROSITE profilePS5129411.674199258IPR017930Myb domain
TIGRFAMsTIGR015573.1E-25202255IPR006447Myb domain, plants
PfamPF002497.9E-7204253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MAPVEDGGGV EFPVGMKVLV VDDDPTCLAV LKRMLLECRY DATTCSQATR ALTMLRENRR  60
GFDVIISDVH MPDMDGFRLL ELVGLEMDLP VIMMSADSRT DIVMKGIKHG ACDYLIKPVR  120
MEELKNIWQH VIRKKFNENK EHEHSGSLDD TDRTRPTNND NEYASSANDG AEGSWKSQKK  180
KRDKDDDDGE LESGDPSSTS KKPRVVWSVE LHQQFVNAVN HLGIDKAVPK KILELMNVPG  240
LTRENVASHL QKFRLYLKRI AQHHAGIANP FCPPASSGKV GSLGGLDFQA LAASGQIPPQ  300
ALAALQDELL GRPTNSLVLP GRDQSSLRLA AVKGNKPHGE REIAFGQPIY KCQNNAYGAF  360
PQSSPAVGGM PSFSAWPNNK LGMADSTGTL GGMSNSQNSN IVLHELQQQP DAMLSGTLHS  420
LDVKPSGIVM PSQSLNTFSA SEGLSPNQNT LMIPAQSSGF LAAMPPSMKH EPVLATSQPS  480
SSLLGGIDLV NQASTSQPLI SAHGGGNLSG LVNRNPNVVP SQGISTFHTP NNPYLVSPNS  540
MGMGSKQPPG VLKTENSDAL NHSYGYLGGS NPPMDSGLLS SQSKNTQFGL LGQDDITGSW  600
SPLPNVDSYG NTVGLSHPGS SSSSFQSSNV ALGKLPDQGR GKNHGFVGKG TCIPSRFAVD  660
EIESPTNNLS HSIGSSGDIM SPDIFGFSGQ M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-24198261164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.119490.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379885270.0
Expression AtlasQ8H7S7-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g12350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Dwarf, narrow leaf, lesion mimic, low tillering and late heading phenotypes. {ECO:0000269|PubMed:16891544}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g12350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2467800.0AB246780.1 Oryza sativa Japonica Group ORR1 mRNA for B-type response regulator, complete cds.
GenBankAK1118990.0AK111899.1 Oryza sativa Japonica Group cDNA clone:J023034P21, full insert sequence.
GenBankAK1118640.0AK111864.1 Oryza sativa Japonica Group cDNA clone:J033025G23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630577.10.0PREDICTED: two-component response regulator ORR21
RefseqXP_015630578.10.0PREDICTED: two-component response regulator ORR21
SwissprotQ8H7S70.0ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLA0A0D9Z4630.0A0A0D9Z463_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HJZ60.0A0A0E0HJZ6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NRU50.0A0A0E0NRU5_ORYRU; Uncharacterized protein
TrEMBLI1P9220.0I1P922_ORYGL; Uncharacterized protein
STRINGLOC_Os03g12350.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
MonocotsOGMP57963754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-113response regulator 1
Publications ? help Back to Top
  1. Pareek A, et al.
    Whole-genome analysis of Oryza sativa reveals similar architecture of two-component signaling machinery with Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 380-97
    [PMID:16891544]
  2. Ito Y,Kurata N
    Identification and characterization of cytokinin-signalling gene families in rice.
    Gene, 2006. 382: p. 57-65
    [PMID:16919402]
  3. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]